1RQQ: Insulin Receptor Kinase

Crystal Structure of the Insulin Receptor Kinase in Complex with the SH2 Domain of APS. Determined by X-ray diffraction at 2.6 Å resolution. Released 30 Dec 2003.

Method: X-ray diffraction
Resolution: 2.6 Å
Organisms: Homo sapiens, Rattus norvegicus
Chains: 6
Atoms: 6,300
Mol. weight: 101 kDa
Ligands: MN, 112
Released: 30 Dec 2003

Explore 1RQQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1RQQ contains 46 α-helices and 40 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 18 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	990	1	1
β-strand	996-1005	10	1
β-strand	1008-1016	9	1
β-strand	1024-1030	7	1
α-helix	1038-1051	14
β-strand	1059	1	2
α-helix	1060-1061	2
β-strand	1062-1066	5	1
α-helix	1072	1
β-strand	1073-1077	5	1
β-strand	1083	1	2
α-helix	1084-1090	7
α-helix	1104-1105	2
α-helix	1106-1125	20
β-strand	1128-1129	2	3
α-helix	1135-1137	3
β-strand	1138-1140	3	2
β-strand	1146-1148	3	2
β-strand	1155-1156	2	3
β-strand	1163-1164	2	4
β-strand	1169-1171	3	5
α-helix	1173-1175	3
α-helix	1178-1183	6
β-strand	1185-1186	2	4
α-helix	1188-1203	16
α-helix	1207-1208	2
α-helix	1215-1223	9
α-helix	1228-1231	4
α-helix	1236-1245	10
α-helix	1250-1252	3
α-helix	1254-1255	2
α-helix	1256-1263	8
α-helix	1271-1274	4

Chains C and D: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	404-406	3
β-strand	410	1	11
α-helix	416-424	9
α-helix	427-430	4
β-strand	434-438	5	11
β-strand	446-452	7	11
β-strand	455-461	7	11
α-helix	470-484	15

Chains E and F: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	105-107	3
β-strand	109-111	3	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Insulin receptor	A, B	protein	306	Homo sapiens	P06213 (AlphaFold model)
adaptor protein APS	C, D	protein	114	Rattus norvegicus	Q9Z200 (AlphaFold model)
Bisubstrate inhibitor	E, F	protein	18

Sequence of entity 1 (A, B), FASTA

>1RQQ_1 Insulin receptor (chains A, B)
VFPSSVYVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESAS
LRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAEN
NPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDI
YETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQ
VLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPNMRPTFLEIVNLLKDDLHPSFPEVSFF
HSEENK

Sequence of entity 2 (C, D), FASTA

>1RQQ_2 adaptor protein APS (chains C, D)
GSHMELELSDYPWFHGTLSRVKAAQLVLAGGPRSHGLFVIRQSETRPGECVLTFNFQGKA
KHLRLSLNGHGQCHVQHLWFQSVFDMLRHFHTHPIPLESGGSADITLRSYVRAQ

Sequence of entity 3 (E, F), FASTA

>1RQQ_3 BISUBSTRATE INHIBITOR (chains E, F)
KKKLPATGDFMNMSPVGD

Ligands and cofactors

ID	Name	Formula	Copies
MN	Manganese (II) ion	Mn	2
112	Thiophosphoric acid O-((adenosyl-phospho)phospho)-S-acetamidyl-diester	C12 H19 N6 O13 P3 S	2

Primary citation

Structural basis for recruitment of the adaptor protein APS to the activated insulin receptor. Hu, J., Liu, J., Ghirlando, R. et al. Mol Cell (2003) 12:1379-1389. DOI 10.1016/S1097-2765(03)00487-8 · PubMed

Other PDB entries of the same protein (UniProt P06213 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3BU3 1.65 Å, Crystal structure of the insulin receptor kinase in complex with IRS2 KRLB peptide
5HHW 1.79 Å, Crystal structure of insulin receptor kinase domain in complex with…
4IBM 1.8 Å, Crystal structure of insulin receptor kinase domain in complex with an inhibitor Irfin-1
5U1M 1.8 Å, Structure of the IRS-1 PTB Domain Bound to the Juxtamembrane Region of the Insulin…
1IR3 1.9 Å, Phosphorylated insulin receptor tyrosine kinase in complex with peptide substrate and…
1P14 1.9 Å, Crystal structure of a catalytic-loop mutant of the insulin receptor tyrosine kinase
3BU6 1.95 Å, Crystal structure of the insulin receptor kinase in complex with IRS2 KRLB phosphopeptide
1IRK 2.1 Å, Crystal structure of the tyrosine kinase domain of the human insulin receptor
3BU5 2.1 Å, Crystal structure of the insulin receptor kinase in complex with IRS2 KRLB peptide and ATP
3EKK 2.1 Å, Insulin receptor kinase complexed with an inhibitor
8DWN 2.15 Å, Crystal structure of bis-phosphorylated insulin receptor kinase domain
3EKN 2.2 Å, Insulin receptor kinase complexed with an inhibitor

Browse structure collections

About this viewer

MolViewer shows 1RQQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.