1RUA: Immunoglobulin igg2a, light chain

Crystal structure (B) of u.v.-irradiated cationic cyclization antibody 4C6 fab at pH 4.6 with a data set collected at SSRL beamline 11-1. Determined by X-ray diffraction at 1.75 Å resolution. Released 2 Mar 2004.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,840
Mol. weight: 48.53 kDa
Ligands: BEZ
Released: 2 Mar 2004

Explore 1RUA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1RUA contains 19 α-helices and 45 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 12 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	7
β-strand	11-12	2	8
β-strand	18-25	8	7
β-strand	33-39	8	9
β-strand	45-52	8	9
β-strand	57-59	3	9
α-helix	61-63	3
β-strand	67-72	6	7
α-helix	73-75	3
β-strand	77-82	6	7
α-helix	84-86	3
β-strand	88-96	9	9
β-strand	102-103	2	9
β-strand	107-109	3	9
β-strand	110-111	2	8
α-helix	114-116	3
β-strand	117	1	10
α-helix	118-119	2
β-strand	120-124	5	11
α-helix	125-127	3
α-helix	128-133	4
β-strand	137-147	11	11
β-strand	148	1	10
β-strand	153-157	4	12
α-helix	162-164	3
β-strand	171-173	3	11
α-helix	174-176	3
β-strand	177-179	3	11
β-strand	184-194	11	11
α-helix	195-198	3
β-strand	206-212	6	12
α-helix	213-215	3
β-strand	217-222	6	12
α-helix	223-227	3

Chain L: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-14	5	2
β-strand	19-25	7	1
β-strand	27C	1	3
β-strand	31	1	3
β-strand	33-38	6	2
β-strand	45-49	5	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-90	7	2
α-helix	96	1
β-strand	97-98	2	2
β-strand	102-107	6	2
β-strand	111	1	4
β-strand	114-118	5	5
α-helix	119-121	3
α-helix	122-127	6
β-strand	129-139	11	5
β-strand	140	1	4
β-strand	145-150	6	6
β-strand	153-155	3	6
β-strand	159-163	5	5
α-helix	164-167	4
β-strand	173-182	10	5
α-helix	183-186	4
β-strand	191-197	7	6
β-strand	205-210	6	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
immunoglobulin igg2a, light chain	L	protein	219	Mus musculus	Q58EU8 (AlphaFold model)
immunoglobulin igg2a, heavy chain	H	protein	222	Mus musculus	P01865 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>1RUA_1 immunoglobulin igg2a, light chain (chains L)
DVVMTQSPKTISVTIGQPASISCKSSQRLLNSNGKTFLNWLLQRPGQSPKRLIYLGTKLD
SGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGTHFPYTFGGGTKLEIKRADAAPTV
SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM
SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 2 (H), FASTA

>1RUA_2 immunoglobulin igg2a, heavy chain (chains H)
RVQLQQSGPGLVKPSQSLSLTCTVTGYSITSDFAWNWIRQFPGNKLEWMGYINYSGFTSH
NPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCAGLLWYDGGAGSWGQGTLVTVSAA
KTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDL
YTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPT

Ligands and cofactors

ID	Name	Formula	Copies
BEZ	Benzoic acid	C7 H6 O2	1

Water and common crystallization additives (GOL, ACT) are not listed.

Primary citation

Probing the antibody-catalyzed water-oxidation pathway at atomic resolution. Zhu, X., Wentworth Jr., P., Wentworth, A.D. et al. Proc Natl Acad Sci U S A (2004) 110:2247-2252. DOI 10.1073/pnas.0307311101 · PubMed

Other PDB entries of the same protein (UniProt Q58EU8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1NCW 1.3 Å, Cationic Cyclization Antibody 4C6 in Complex with Benzoic Acid
9H8H 1.33 Å, Structure of DC11 anti tau antibody Fab fragment
1RUM 1.48 Å, Crystal structure (F) of H2O2-soaked cationic cyclization antibody 4C6 fab at pH 8.5…
1YEJ 1.85 Å, Catalytic antibody complex
1KN2 1.9 Å, Catalytic antibody D2.3 complex
1KN4 1.9 Å, Catalytic antibody D2.3 complex
1YEI 1.9 Å, Catalytic antibody D2.3 complex
2C1P 2.0 Å, Fab-fragment of enantioselective antibody complexed with finrozole
1YEK 2.1 Å, Catalytic antibody D2.3 complex
1ND0 2.45 Å, Cationic cyclization antibody 4C6 complex with transition state analog
2C1O 2.75 Å, ENAIIHis Fab fragment in the free form

Browse structure collections

About this viewer

MolViewer shows 1RUA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.