2C1O: ENAIIHis Fab fragment in the free form

ENAIIHis Fab fragment in the free form. Determined by X-ray diffraction at 2.75 Å resolution. Released 25 Jan 2006.

Method: X-ray diffraction
Resolution: 2.75 Å
Organism: MUS MUSCULUS
Chains: 4
Atoms: 6,848
Mol. weight: 103.17 kDa
Released: 25 Jan 2006

Explore 2C1O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2C1O contains 27 α-helices and 93 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	27C	1	3
β-strand	31	1	3
β-strand	33-38	6	2
β-strand	45-49	5	2
β-strand	53-54	2	2
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	85-90	6	2
β-strand	97-98	2	2
β-strand	99	1	1
β-strand	102-106	5	2
β-strand	111	1	4
α-helix	112-113	2
β-strand	114-118	5	5
α-helix	119-121	3
α-helix	122-126	5
β-strand	129-139	11	5
β-strand	140	1	4
β-strand	145-150	6	6
β-strand	154-155	2	6
β-strand	159-163	5	5
β-strand	173-182	10	5
α-helix	183-187	5
β-strand	191-197	7	6
β-strand	205-210	6	6

Chain B: 9 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	7
α-helix	7-8	2
β-strand	10-12	3	8
β-strand	17-25	9	7
α-helix	29-31	3
β-strand	34-39	6	8
β-strand	46-51	6	8
β-strand	57-59	3	8
α-helix	61-63	3
β-strand	67-72	6	7
α-helix	73-75	3
β-strand	77-82A	7	7
α-helix	84-86	3
β-strand	88-96	9	8
β-strand	99-103	4	8
β-strand	107-111	5	8
β-strand	117	1	9
β-strand	120-124	5	10
β-strand	135-145	11	10
β-strand	146	1	9
β-strand	151-154	4	11
α-helix	155-157	3
β-strand	159	1	11
β-strand	163-165	3	10
α-helix	166-168	3
β-strand	169-171	3	10
β-strand	174-184	11	10
β-strand	194-199	6	11
α-helix	200-202	3
β-strand	204-209	6	11
α-helix	211-213	3

Chain H: 7 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	12
α-helix	7-8	2
β-strand	10-12	3	13
β-strand	18-25	8	12
β-strand	34-39	6	13
β-strand	46-51	6	13
β-strand	57-59	3	13
α-helix	61-63	3
β-strand	69-72	4	12
β-strand	77-82	6	12
β-strand	88-93	6	13
β-strand	94-96	3	14
β-strand	99-102	3	14
β-strand	104	1	12
β-strand	107-111	5	13
α-helix	114-116	3
β-strand	117	1	15
β-strand	120-124	5	16
α-helix	131-133	3
β-strand	135-145	11	16
β-strand	146	1	15
β-strand	151-154	4	17
α-helix	155-157	3
β-strand	159	1	17
β-strand	163-165	3	16
α-helix	166-168	3
β-strand	169-171	3	16
β-strand	174-184	11	16
β-strand	194-199	6	17
α-helix	200-202	3
β-strand	204-209	6	17

Chain L: 6 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	18
β-strand	10-11	2	19
β-strand	19-25	7	18
β-strand	27C	1	20
β-strand	31	1	20
β-strand	33-38	6	19
β-strand	45-49	5	19
β-strand	53-54	2	19
α-helix	55	1
β-strand	62-67	6	18
β-strand	70-75	6	18
α-helix	80-82	3
β-strand	84-90	7	19
α-helix	96	1
β-strand	97-98	2	19
β-strand	102-104	3	19
β-strand	111	1	21
β-strand	114-118	5	22
α-helix	119-121	3
α-helix	122-126	5
β-strand	129-139	11	22
β-strand	140	1	21
β-strand	145-150	6	23
β-strand	155	1	23
β-strand	159-163	5	22
β-strand	173-182	10	22
α-helix	183-187	5
β-strand	191-197	7	23
β-strand	205-210	6	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Igk-C protein	A, L	protein	254	MUS MUSCULUS	Q58EU8 (AlphaFold model)
Igh-4 protein	B, H	protein	218	MUS MUSCULUS

Sequence of entity 1 (A, L), FASTA

>2C1O_1 IGK-C PROTEIN (chains A, L)
VQLQQSGAELVRPGTSVKLSCKASGYSFTNYWMNWLRELVMTQSPLTLSVTIGQPASISC
KSSQSLLYSNGKTYLNWLLQRPGQSPKRLIYLVSKLDSGDPDRFTGSGSGTDFTLKISRV
EAEDLGIYYCVQGSHFPPTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNN
FYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATH
KTSTSPIVKSFNRN

Sequence of entity 2 (B, H), FASTA

>2C1O_2 IGH-4 PROTEIN (chains B, H)
EVQLQQSGAELVRPGTSVKLSCKASGYSFTNYWMNWLRQRPGQGLDWIGMIHPSDSETRL
NQKFKDKATLTVDRSSSTAYIQLSSPTSEDSAVYYCARDDYDGAFWGQGTLVTVSAAKTT
PPSVYPLAPGSAAQTNSMVTLGCLVKGYFPAPVTVTWNSGSLSSGVHTFPAVLQSDLYTL
SSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC

Primary citation

Crystal Structures of an Enantioselective Fab-Fragment in Free and Complex Forms. Parkkinen, T., Nevanen, T.K., Koivula, A. et al. J Mol Biol (2006) 357:471. DOI 10.1016/J.JMB.2005.12.045 · PubMed

Other PDB entries of the same protein (UniProt Q58EU8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1NCW 1.3 Å, Cationic Cyclization Antibody 4C6 in Complex with Benzoic Acid
9H8H 1.33 Å, Structure of DC11 anti tau antibody Fab fragment
1RUM 1.48 Å, Crystal structure (F) of H2O2-soaked cationic cyclization antibody 4C6 fab at pH 8.5…
1RUA 1.75 Å, Crystal structure (B) of u.v.-irradiated cationic cyclization antibody 4C6 fab at pH 4.6…
1YEJ 1.85 Å, Catalytic antibody complex
1KN2 1.9 Å, Catalytic antibody D2.3 complex
1KN4 1.9 Å, Catalytic antibody D2.3 complex
1YEI 1.9 Å, Catalytic antibody D2.3 complex
2C1P 2.0 Å, Fab-fragment of enantioselective antibody complexed with finrozole
1YEK 2.1 Å, Catalytic antibody D2.3 complex
1ND0 2.45 Å, Cationic cyclization antibody 4C6 complex with transition state analog

Browse structure collections

About this viewer

MolViewer shows 2C1O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.