1RUZ: 1918 H1 Hemagglutinin

1918 H1 Hemagglutinin. Determined by X-ray diffraction at 2.9 Å resolution. Released 30 Mar 2004.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Influenza A virus (A/South Carolina/1/18 (H1N1))
Chains: 6
Atoms: 12,108
Mol. weight: 165.45 kDa
Ligands: NDG, NAG
Released: 30 Mar 2004

Explore 1RUZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1RUZ contains 36 α-helices and 156 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains H and J: 8 helices, 41 β-strands

Element	Residues	Length	Sheet
β-strand	6-8	3	1
β-strand	9-11	3	2
β-strand	12	1	3
β-strand	19-20	2	4
β-strand	28-29	2	4
β-strand	30	1	5
β-strand	33-35	3	6
β-strand	37-38	2	7
β-strand	46-49	4	8
β-strand	51	1	8
β-strand	54-57	4	9
β-strand	59	1	10
α-helix	61-66	6
α-helix	69-71	3
α-helix	73-76	4
β-strand	79	1	11
β-strand	83-85	3	9
β-strand	91	1	10
β-strand	99	1	11
α-helix	102-109	8
β-strand	112-119	8	11
β-strand	131	1	12
β-strand	136-142	7	13
β-strand	144-146	3	13
β-strand	151-153	3	11
β-strand	155	1	12
β-strand	164-169	6	14
β-strand	175-184	10	11
α-helix	188-195	8
β-strand	202-205	4	14
β-strand	210-213	4	14
β-strand	229-237	9	11
α-helix	238	1
β-strand	242-247	6	14
β-strand	251-254	4	11
β-strand	256-262	7	11
β-strand	268-270	3	9
α-helix	273-274	2
β-strand	275-280	6	8
β-strand	282-284	3	15
β-strand	287-289	3	15
β-strand	295-296	2	7
β-strand	302	1	16
β-strand	303-304	2	15
β-strand	306	1	17
α-helix	307	1
β-strand	308-309	2	7
β-strand	316-318	3	6
β-strand	322	1	5

Chains I and K: 4 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	506	1	18
β-strand	510	1	18
β-strand	514	1	3
β-strand	522-524	3	2
β-strand	527	1	1
β-strand	528	1	19
β-strand	531	1	19
β-strand	535-536	2	2
α-helix	538-557	20
α-helix	560-561	2
β-strand	562	1	17
β-strand	565	1	16
α-helix	575-626	52
β-strand	630-632	3	1
β-strand	637-640	4	1
α-helix	646-652	7

Chain L: 8 helices, 39 β-strands

Element	Residues	Length	Sheet
β-strand	6-8	3	39
β-strand	9-11	3	40
β-strand	12	1	41
β-strand	19-20	2	42
β-strand	28-29	2	42
β-strand	30	1	43
β-strand	33-35	3	44
β-strand	37-38	2	45
β-strand	46-49	4	46
β-strand	51	1	46
β-strand	54-57	4	47
β-strand	59	1	48
α-helix	61-66	6
α-helix	69-71	3
α-helix	73-76	4
β-strand	79	1	49
β-strand	83-85	3	47
β-strand	91	1	48
β-strand	99	1	49
α-helix	102-109	8
β-strand	112-119	8	49
β-strand	131	1	50
β-strand	136-142	7	51
β-strand	144-146	3	51
β-strand	151-153	3	49
β-strand	155	1	50
β-strand	164-169	6	52
β-strand	175-184	10	49
α-helix	188-195	8
β-strand	202-205	4	52
β-strand	210-213	4	52
β-strand	229-237	9	49
α-helix	238	1
β-strand	242-247	6	52
β-strand	251-254	4	49
β-strand	256-262	7	49
β-strand	268-270	3	47
α-helix	273-274	2
β-strand	275-280	6	46
β-strand	282-284	3	53
β-strand	287-289	3	53
β-strand	295-296	2	45
β-strand	302-306	5	54
α-helix	307	1
β-strand	308-309	2	45
β-strand	316-318	3	44
β-strand	322	1	43

Chain M: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	506	1	55
β-strand	510	1	55
β-strand	514	1	41
β-strand	522-524	3	40
β-strand	527	1	39
β-strand	528	1	56
β-strand	531	1	56
β-strand	535-536	2	40
α-helix	538-557	20
α-helix	560-561	2
β-strand	562-565	4	54
α-helix	575-626	52
β-strand	630-632	3	39
β-strand	637-640	4	39
α-helix	646-652	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
hemagglutinin	H, J, L	protein	328	Influenza A virus (A/South Carolina/1/18 (H1N1))	Q9WFX3
hemagglutinin	I, K, M	protein	160	Influenza A virus (A/South Carolina/1/18 (H1N1))	Q9WFX3

Sequence of entity 1 (H, J, L), FASTA

>1RUZ_1 hemagglutinin (chains H, J, L)
ATNADTICIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDSHNGKLCKLKGIAPLQLGKCN
IAGWLLGNPECDLLLTASSWSYIVETSNSENGTCYPGDFIDYEELREQLSSVSSFEKFEI
FPKTSSWPNHETTKGVTAACSYAGASSFYRNLLWLTKKGSSYPKLSKSYVNNKGKEVLVL
WGVHHPPTGTDQQSLYQNADAYVSVGSSKYNRRFTPEIAARPKVRDQAGRMNYYWTLLEP
GDTITFEATGNLIAPWYAFALNRGSGSGIITSDAPVHDCNTKCQTPHGAINSSLPFQNIH
PVTIGECPKYVRSTKLRMATGLRNIPAR

Sequence of entity 2 (I, K, M), FASTA

>1RUZ_2 hemagglutinin (chains I, K, M)
GLFGAIAGFIEGGWTGMIDGWYGYHHQNEQGSGYAADQKSTQNAIDGITNKVNSVIEKMN
TQFTAVGKEFNNLERRIENLNKKVDDGFLDIWTYNAELLVLLENERTLDFHDSNVRNLYE
KVKSQLKNNAKEIGNGCFEFYHKCDDACMESVRNGTYDYP

Ligands and cofactors

ID	Name	Formula	Copies
NDG	2-acetamido-2-deoxy-alpha-D-glucopyranose	C8 H15 N O6	9
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

The structure and receptor binding properties of the 1918 influenza hemagglutinin. Gamblin, S.J., Haire, L.F., Russell, R.J. et al. Science (2004) 303:1838-1842. DOI 10.1126/science.1093155 · PubMed

Other PDB entries of the same protein (UniProt Q9WFX3), best resolution first:

4GXX 1.8 Å, Crystal structure of the "avianized" 1918 influenza virus hemagglutinin
5VMC 2.15 Å, Influenza hemagglutinin H1 mutant DH1 in complex with 6'SLN
3GBN 2.2 Å, Crystal Structure of Fab CR6261 in Complex with the 1918 H1N1 influenza virus…
5VMF 2.35 Å, Influenza hemagglutinin H1 mutant DH1D in complex with 6'SLN
5VMG 2.45 Å, Influenza hemagglutinin H1 mutant DH1E in complex with 6'SLN
4JUG 2.7 Å, Crystal structure of 1918 pandemic influenza virus hemagglutinin mutant D225G
4EEF 2.7 Å, Crystal structure of the designed inhibitor protein F-HB80.4 in complex with the 1918…
3LZF 2.8 Å, Crystal Structure of Fab 2D1 in Complex with the 1918 Influenza Virus Hemagglutinin
4JUH 2.81 Å, Crystal structure of 1918 pandemic influenza virus hemagglutinin mutant D225G complexed…
4PY8 2.91 Å, Crystal structure of Fab 3.1 in complex with the 1918 influenza virus hemagglutinin
5VMJ 2.95 Å, Influenza hemagglutinin H1 mutant DH1E in complex with 3'SLN
1RD8 3.0 Å, Crystal Structure of the 1918 Human H1 Hemagglutinin Precursor (HA0)

Browse structure collections

About this viewer

MolViewer shows 1RUZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.