1S4G: Somatomedin-B Domain of human plasma vitronectin

Somatomedin-B Domain of human plasma vitronectin. Determined by solution NMR. Released 8 Jun 2004.

Method

Solution NMR

Organism

Homo sapiens

Chains

1

Atoms

399

Mol. weight

5.82 kDa

Released

8 Jun 2004

Explore 1S4G in 3D Show helices and sheets RCSB PDB PDBe

Molecules and chains

>1S4G_1 Vitronectin (chains A)
DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTM

Primary citation

The solution structure of the N-terminal domain of human vitronectin: proximal sites that regulate fibrinolysis and cell migration. Mayasundari, A., Whittemore, N.A., Serpersu, E.H. et al. J Biol Chem (2004) 279:29359-29366. DOI 10.1074/jbc.M401279200 · PubMed

Related structures

Other PDB entries of the same protein (UniProt P04004 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 7RJ9 1.7 Å, Crystal structure of the Vitronectin hemopexin-like domain binding Calcium
• 6O5E 1.9 Å, Crystal structure of the Vitronectin hemopexin-like domain
• 1OC0 2.28 Å, plasminogen activator inhibitor-1 complex with somatomedin B domain of vitronectin
• 3BT2 2.5 Å, Structure of urokinase receptor, urokinase and vitronectin complex
• 3BT1 2.8 Å, Structure of urokinase receptor, urokinase and vitronectin complex
• 4K24 4.5 Å, Structure of anti-uPAR Fab ATN-658 in complex with uPAR
• 1SSU Structural and biochemical evidence for disulfide bond heterogeneity in active forms of…
• 2JQ8 Solution structure of the Somatomedin B domain from vitronectin produced in Pichia…

Browse structure collections

About this viewer

MolViewer shows 1S4G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.