1S4Z: HP1 chromo shadow domain

HP1 chromo shadow domain in complex with PXVXL motif of CAF-1. Determined by solution NMR. Released 23 Mar 2004.

Method: Solution NMR
Organism: Mus musculus
Chains: 3
Atoms: 1,429
Mol. weight: 20.37 kDa
Released: 23 Mar 2004

Explore 1S4Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1S4Z contains 6 α-helices and 14 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	117-118	2
β-strand	119	1	1
β-strand	127	1	2
β-strand	132	1	2
β-strand	133-136	4	3
β-strand	138	1	1
β-strand	145-148	4	3
α-helix	149-155	7
α-helix	157-166	10
β-strand	168	1	4

Chain B: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	119-122	4	5
β-strand	126-128	3	6
β-strand	131-133	3	6
β-strand	136-138	3	5
β-strand	148	1	6
α-helix	149-155	7
α-helix	157-166	10
β-strand	168-170	3	4
α-helix	171-173	3

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	222-224	3	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chromobox protein homolog 1	A, B	protein	75	Mus musculus	P83917 (AlphaFold model)
Chromatin assembly factor 1 subunit A	C	protein	30	Mus musculus	Q9QWF0 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1S4Z_1 Chromobox protein homolog 1 (chains A, B)
HMKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVI
SFYEERLTWHSYPSD

Sequence of entity 2 (C), FASTA

>1S4Z_2 Chromatin assembly factor 1 subunit A (chains C)
GSKAGDLLFIEKVPVVVLEDILATKPSIAS

Primary citation

Structural basis of HP1/PXVXL motif peptide interactions and HP1 localisation to heterochromatin. Thiru, A., Nietlispach, D., Mott, H.R. et al. EMBO J (2004) 23:489-499. DOI 10.1038/sj.emboj.7600088 · PubMed

Other PDB entries of the same protein (UniProt P83917 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1AP0 Structure of the chromatin binding (CHROMO) domain from mouse modifier protein 1, NMR,…
1DZ1 Mouse HP1 (M31) C terminal (shadow chromo) domain
1GUW Structure of the chromodomain from mouse HP1beta in complex with the lysine 9-methyl…

Browse structure collections

About this viewer

MolViewer shows 1S4Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.