1SBB: T-cell receptor beta chain

T-cell receptor beta chain complexed with superantigen seb. Determined by X-ray diffraction at 2.4 Å resolution. Released 1 Mar 1999.

Method: X-ray diffraction
Resolution: 2.4 Å
Organisms: Mus musculus, Staphylococcus aureus
Chains: 4
Atoms: 7,748
Mol. weight: 109.96 kDa
Released: 1 Mar 1999

Explore 1SBB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1SBB contains 32 α-helices and 86 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-14	5	2
β-strand	19-21	3	3
β-strand	22-25	4	1
β-strand	31-37	7	2
β-strand	39	1	4
β-strand	41	1	4
β-strand	43-49	7	2
β-strand	56-57	2	2
β-strand	66-68	3	3
β-strand	74	1	1
β-strand	76-79	4	3
α-helix	84-86	3
β-strand	88-95	8	2
β-strand	106-108	3	2
β-strand	112-250	6	2
α-helix	119-121	3
β-strand	123	1	5
β-strand	126-130	5	6
α-helix	134-136	3
β-strand	145-152	8	6
β-strand	153	1	5
β-strand	157-163	7	7
β-strand	166-168	3	7
β-strand	172-174	3	6
α-helix	178	1
β-strand	179-182	4	6
β-strand	189-196	8	6
α-helix	200-203	4
β-strand	209-216	8	7
α-helix	230-231	2
β-strand	236-242	7	7

Chain B: 11 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	4-5	2
α-helix	8-10	3
α-helix	12-13	2
α-helix	14-16	3
β-strand	17	1	8
α-helix	22-25	4
α-helix	26-28	3
β-strand	33-38	6	9
β-strand	40-42	3	10
β-strand	48-51	4	10
β-strand	63-67	5	10
α-helix	71-77	7
β-strand	82-86	5	9
β-strand	89	1	10
β-strand	111-115	5	10
β-strand	118-120	3	9
β-strand	125-138	14	11
β-strand	141-152	12	11
β-strand	154-156	3	12
α-helix	157-172	16
β-strand	182-190	9	11
β-strand	195-199	5	11
α-helix	202-203	2
β-strand	205	1	8
α-helix	210-214	5
α-helix	215-217	3
β-strand	222-224	3	12
β-strand	229-236	8	11

Chain C: 4 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	13
β-strand	10-14	5	2
β-strand	19-21	3	14
β-strand	22-25	4	13
β-strand	31-37	7	2
β-strand	43-49	7	2
β-strand	56-57	2	2
β-strand	66-68	3	14
β-strand	74	1	13
β-strand	76-79	4	14
α-helix	84-86	3
β-strand	88-95	8	2
β-strand	107-108	2	2
β-strand	112-250	6	2
α-helix	119-121	3
β-strand	123	1	15
β-strand	126-130	5	16
α-helix	134-136	3
β-strand	145-152	8	16
β-strand	153	1	15
β-strand	157-163	7	17
β-strand	166-168	3	17
β-strand	172-174	3	16
β-strand	179-182	4	16
β-strand	189-196	8	16
α-helix	200-204	5
β-strand	209-216	8	17
β-strand	227	1	18
β-strand	229	1	18
β-strand	236-242	7	17

Chain D: 11 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	4-7	4
α-helix	8-10	3
α-helix	12-13	2
α-helix	14-16	3
β-strand	17	1	19
α-helix	22-25	4
α-helix	26-28	3
β-strand	33-38	6	20
β-strand	42	1	21
β-strand	48-52	5	21
β-strand	63-67	5	21
α-helix	71-77	7
β-strand	82-86	5	20
β-strand	89	1	21
β-strand	111-115	5	21
β-strand	118-120	3	20
β-strand	125-138	14	22
β-strand	141-152	12	22
β-strand	154-156	3	23
α-helix	157-172	16
β-strand	182-190	9	22
β-strand	195-199	5	22
α-helix	202-203	2
β-strand	205	1	19
α-helix	210-214	5
α-helix	215-217	3
β-strand	222-224	3	23
β-strand	229-236	8	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (14.3.D T cell antigen receptor)	A, C	protein	238	Mus musculus	P01852 (AlphaFold model)
Protein (staphylococcal enterotoxin B)	B, D	protein	239	Staphylococcus aureus	P01552 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>1SBB_1 PROTEIN (14.3.D T CELL ANTIGEN RECEPTOR) (chains A, C)
AVTQSPRNKVAVTGGKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPD
GYKASRPSQEQFSLILELATPSQTSVYFCASGGGRGSYAEQFFGPGTRLTVLEDLRQVTP
PKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVSTDPQAYKESNY
SYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRAD

Sequence of entity 2 (B, D), FASTA

>1SBB_2 PROTEIN (STAPHYLOCOCCAL ENTEROTOXIN B) (chains B, D)
ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGN
YDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTE
HNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNS
PYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK

Primary citation

Three-dimensional structure of the complex between a T cell receptor beta chain and the superantigen staphylococcal enterotoxin B. Li, H., Llera, A., Tsuchiya, D. et al. Immunity (1998) 9:807-816. DOI 10.1016/S1074-7613(00)80646-9 · PubMed

Other PDB entries of the same protein (UniProt P01852 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6G9Q 1.89 Å, Ternary complex of P14 TCR with murine MHC class I H-2 Db in complex with self-antigen…
1G6R 2.8 Å, A functional hot spot for antigen recognition in a superagonist tcr/mhc complex
1NFD 2.8 Å, An alpha-beta T cell receptor (TCR) heterodimer in complex with an anti-TCR FAB fragment…
3MBE 2.89 Å, TCR 21.30 in complex with MHC class II I-Ag7HEL(11-27)
3C6L 3.4 Å, Crystal structure of mouse MHC class II I-Ab/3K peptide complexed with mouse TCR 2W20

Browse structure collections

About this viewer

MolViewer shows 1SBB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.