1G6R: Alpha T cell receptor

A functional hot spot for antigen recognition in a superagonist tcr/mhc complex. Determined by X-ray diffraction at 2.8 Å resolution. Released 15 Nov 2000.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Mus musculus
Chains: 10
Atoms: 13,100
Mol. weight: 185.94 kDa
Released: 15 Nov 2000

Explore 1G6R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1G6R contains 32 α-helices and 160 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	2-3	2	1
β-strand	9-13	5	2
β-strand	18-20	3	3
β-strand	24-25	2	1
β-strand	31-37	7	2
β-strand	44-49	6	2
β-strand	55-57	3	3
β-strand	63-67	5	3
β-strand	72-77	6	3
α-helix	82-84	3
β-strand	86-93	8	2
β-strand	105-106	2	2
β-strand	110-115	6	2
β-strand	124-128	5	4
β-strand	140-144	5	4
β-strand	160-168	9	4
β-strand	177-184	8	4
α-helix	191-194	4

Chain B: 5 helices, 32 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	5
β-strand	10-14	5	6
β-strand	20-21	2	7
β-strand	24-25	2	5
β-strand	32-37	6	6
β-strand	38	1	8
β-strand	42	1	8
β-strand	45	1	6
β-strand	47-48	2	9
β-strand	49	1	6
β-strand	56-57	2	9
β-strand	66-68	3	7
β-strand	76-78	3	7
α-helix	84-86	3
β-strand	88-94	7	6
β-strand	107-108	2	6
β-strand	109	1	5
β-strand	112-316	6	6
β-strand	126-130	5	10
α-helix	131-133	3
α-helix	134-140	7
β-strand	142	1	11
β-strand	146-152	7	10
β-strand	157-163	7	12
β-strand	166-168	3	12
β-strand	172	1	13
β-strand	179-182	4	10
β-strand	189-195	7	10
β-strand	196	1	13
β-strand	199	1	11
α-helix	200-203	4
β-strand	209-216	8	12
β-strand	219	1	14
α-helix	230-231	2
β-strand	233	1	14
β-strand	235-238	4	12
β-strand	241-242	2	12

Chain C: 5 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	9-13	5	25
β-strand	18-20	3	26
β-strand	32-37	6	25
α-helix	41-43	3
β-strand	44-45	2	25
β-strand	49	1	25
β-strand	55	1	26
β-strand	58	1	26
β-strand	62-67	6	26
α-helix	68-70	3
β-strand	72-77	6	26
α-helix	82-84	3
β-strand	86-92	7	25
β-strand	105-106	2	25
β-strand	110-115	6	25
β-strand	124	1	27
β-strand	127	1	27
β-strand	141-144	4	27
α-helix	151-154	4
β-strand	162	1	27
β-strand	166-168	3	27
β-strand	177-182	6	27
α-helix	191-194	4

Chain D: 4 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	28
β-strand	10-12	3	29
β-strand	32-37	6	29
β-strand	38	1	30
β-strand	42	1	30
β-strand	45	1	29
β-strand	47-48	2	31
β-strand	49	1	29
β-strand	56-57	2	31
β-strand	68	1	32
β-strand	76	1	32
α-helix	84-86	3
β-strand	88-94	7	29
β-strand	107	1	29
β-strand	109	1	28
β-strand	112-115	4	29
α-helix	119-121	3
β-strand	126-130	5	33
α-helix	134-139	6
β-strand	142-144	3	34
β-strand	146-150	5	33
β-strand	159-163	5	35
β-strand	166-167	2	35
β-strand	179-182	4	36
β-strand	189-191	3	36
β-strand	192-194	3	33
β-strand	197-199	3	34
α-helix	200-203	4
β-strand	210-216	7	35
β-strand	219	1	37
β-strand	233	1	37
β-strand	235-241	7	35

Chains H and I: 7 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	3-12	10	15
β-strand	21-28	8	15
β-strand	31-37	7	15
β-strand	46-47	2	15
α-helix	50-54	5
α-helix	57-84	28
β-strand	94-103	10	15
β-strand	109-118	10	15
β-strand	122-126	5	15
β-strand	133-134	2	15
α-helix	138-148	11
α-helix	152-158	7
α-helix	159-163	5
α-helix	164-174	11
β-strand	183	1	16
β-strand	186-194	9	17
β-strand	198-208	11	17
β-strand	209	1	16
β-strand	214-218	5	18
β-strand	219	1	19
β-strand	222	1	19
β-strand	229-230	2	17
β-strand	234-235	2	17
β-strand	241-250	10	17
α-helix	254-256	3
β-strand	258-262	5	18
β-strand	270-273	4	18

Chain L: 1 helix, 14 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	20
β-strand	6	1	21
β-strand	9-11	3	22
β-strand	21-25	5	22
β-strand	27-30	4	23
β-strand	31	1	20
β-strand	36-41	6	24
β-strand	44-45	2	24
β-strand	50-51	2	22
α-helix	52-54	3
β-strand	55-56	2	23
β-strand	62-64	3	23
β-strand	66-70	5	22
β-strand	78-83	6	24
β-strand	91-94	4	24

Chain M: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	43
β-strand	6	1	44
β-strand	9-11	3	44
β-strand	21-30	10	44
β-strand	31	1	43
β-strand	36-41	6	45
β-strand	44-45	2	45
β-strand	50-51	2	44
α-helix	52-54	3
β-strand	55-56	2	44
β-strand	62-70	9	44
β-strand	78-83	6	45
β-strand	91-94	4	45

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha T cell receptor	A, C	protein	202	Mus musculus	P01738 (AlphaFold model)
Beta T cell receptor	B, D	protein	237	Mus musculus	P01852 (AlphaFold model)
Major histocompatibility complex class I molecule	H, I	protein	274	Mus musculus	P01901 (AlphaFold model)
Beta-2 microglobulin	L, M	protein	99	Mus musculus	P01887 (AlphaFold model)
Siyr peptide	P, Q	protein	8

Sequence of entity 1 (A, C), FASTA

>1G6R_1 ALPHA T CELL RECEPTOR (chains A, C)
QSVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGLQLLLKYYSGDPVVQGVN
GFEAEFSKSNSSFHLRKASVHWSDSAVYFCAVSGFASALTFGSGTKVIVLPYIQNPEPAV
YALKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDATVLDMKAMDSKSNGAIAWSNQT
SFTCQDIFKETNATYPSSDVPC

Sequence of entity 2 (B, D), FASTA

>1G6R_2 BETA T CELL RECEPTOR (chains B, D)
EAAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDI
PDGYKASRPSQENFSLILELATPSQTSVYFCASGGGGTLYFGAGTRLSVLEDLRNVTPPK
VSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVSTDPQAYKESNYSY
CLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADC

Sequence of entity 3 (H, I), FASTA

>1G6R_3 MAJOR HISTOCOMPATIBILITY COMPLEX CLASS I MOLECULE (chains H, I)
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYW
ERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDG
CDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLL
RTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGT
FQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW

Sequence of entity 4 (L, M), FASTA

>1G6R_4 BETA-2 MICROGLOBULIN (chains L, M)
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDW
SFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM

Sequence of entity 5 (P, Q), FASTA

>1G6R_5 SIYR PEPTIDE (chains P, Q)
SIYRYYGL

Primary citation

A functional hot spot for antigen recognition in a superagonist TCR/MHC complex. Degano, M., Garcia, K.C., Apostolopoulos, V. et al. Immunity (2000) 12:251-261. DOI 10.1016/S1074-7613(00)80178-8 · PubMed

Other PDB entries of the same protein (UniProt P01738 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2OI9 2.35 Å, Structure of the 2C/Ld/QL9 allogeneic complex
1MWA 2.4 Å, 2C/H-2KBM3/DEV8 allogeneic complex
2ICW 2.41 Å, Crystal structure of a complete ternary complex between TCR, superantigen, and…
1I9E 2.5 Å, TCR domain
1TCR 2.5 Å, Murine T-cell antigen receptor 2C clone
4MXQ 2.6 Å, 42F3 TCR pCPC5/H-2Ld Complex
4N0C 2.9 Å, 42F3 TCR pCPE3/H-2Ld complex
4NHU 2.9 Å, The M33 TCR p3M33l/H-2 Ld Complex
3E3Q 2.95 Å, Structure of the 3alpham13 high-affinity mutant of the 2C TCR in complex with Ld/QL9
2CKB 3.0 Å, Structure of the 2C/KB/DEV8 complex
4N5E 3.06 Å, 42F3 TCR pCPA12/H-2Ld complex
4MVB 3.09 Å, 42F3 pCPB7/H-2Ld Complex

Browse structure collections

About this viewer

MolViewer shows 1G6R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.