Crystal structure of a toxin chimera between Lqh-alpha-IT from the scorpion Leiurus quinquestriatus hebraeus and AAH2 from Androctonus australis hector. Determined by X-ray diffraction at 1.3 Å resolution. Released 31 Aug 2004.
Explore 1SEG in 3D Show helices and sheets RCSB PDB PDBe
1SEG contains 1 α-helix and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-5 | 4 | 1 |
| β-strand | 6 | 1 | 2 |
| β-strand | 7-8 | 2 | 3 |
| β-strand | 12-13 | 2 | 3 |
| α-helix | 19-28 | 10 | |
| β-strand | 33-41 | 9 | 1 |
| β-strand | 43-51 | 9 | 1 |
| β-strand | 57 | 1 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| AAH2: lqh-alpha-it (FACE) chimeric toxin | A | protein | 64 | Androctonus australis hector | P01484 (AlphaFold model) |
>1SEG_1 AAH2: LQH-ALPHA-IT (FACE) CHIMERIC TOXIN (chains A) VKDGYIVKNYNCTYFCFRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVPIRVP GKCH
| ID | Name | Formula | Copies |
|---|---|---|---|
| PPI | Propanoic acid | C3 H6 O2 | 1 |
Water and common crystallization additives (NO3, SO4) are not listed.
Molecular basis of the high insecticidal potency of scorpion alpha-toxins. Karbat, I., Frolow, F., Froy, O. et al. J Biol Chem (2004) 279:31679-31686. DOI 10.1074/jbc.M402048200 · PubMed
Other PDB entries of the same protein (UniProt P01484 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1SEG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.