1SEQ: Fab MNAC13

Fab MNAC13. Determined by X-ray diffraction at 1.78 Å resolution. Released 1 Mar 2005.

Method: X-ray diffraction
Resolution: 1.78 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,621
Mol. weight: 47.7 kDa
Ligands: IPA
Released: 1 Mar 2005

Explore 1SEQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1SEQ contains 16 α-helices and 45 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 8 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	6
β-strand	10-12	3	7
β-strand	18-25	8	6
α-helix	29-31	3
β-strand	34-39	6	7
β-strand	45-51	7	7
β-strand	57-58	2	7
β-strand	67-72	6	6
α-helix	73-75	3
β-strand	77-82	6	6
α-helix	84-86	3
β-strand	88-94	7	7
β-strand	97-99	3	8
β-strand	100B-100D	3	8
α-helix	100E	1
β-strand	101	1	7
β-strand	107-111	5	7
α-helix	115-116	2
β-strand	117	1	9
β-strand	120-124	5	10
β-strand	135-145	11	10
β-strand	146	1	9
β-strand	151-154	4	11
α-helix	155-157	3
β-strand	159	1	11
β-strand	163-165	3	10
α-helix	166-168	3
β-strand	169-171	3	10
β-strand	174-184	11	10
β-strand	194-199	6	11
α-helix	200-202	3
β-strand	204-209	6	11

Chain L: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	34-38	5	2
β-strand	45-49	5	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-90	7	2
α-helix	96	1
β-strand	97-98	2	2
β-strand	102-106	5	2
α-helix	106A	1
β-strand	110	1	3
β-strand	113-117	5	4
α-helix	118-120	3
α-helix	121-125	5
β-strand	128-138	11	4
β-strand	139	1	3
β-strand	144-149	6	5
β-strand	152-154	3	5
β-strand	158-162	5	4
α-helix	163-166	4
β-strand	172-181	10	4
α-helix	182-186	5
β-strand	190-196	7	5
β-strand	204-209	6	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Monoclonal Antibody MNAC13	L	protein	213	Mus musculus	P01837 (AlphaFold model)
Monoclonal Antibody MNAC13	H	protein	225	Mus musculus	P01868 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>1SEQ_1 Monoclonal Antibody MNAC13 (chains L)
DIVLTQSPAIMSASLGSSVTLTCSASSSVSYMHWYQQKSGTSPVLLIYTTSNLASGVPSR
FSGSGSGTFYSLTISSVEASDAADYYCHQWSSYPWTFGGGTKLEIKRADAAPTVSIFPPS
SEQLTSGGASVVCFLNNFYPKSINSKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTL
TKNEYERHNSYTCEATHKTSTSPIVKSFNRSEC

Sequence of entity 2 (H), FASTA

>1SEQ_2 Monoclonal Antibody MNAC13 (chains H)
EVKLVESGGGLVQPGGSLKLSCAASGFTFSTYTMSWARQTPEKKLEWVAYISKGGGSTYY
PDTVKGRFTISRDNAKNTLYLQMSSLKSEDTALYYCARGAMFGNDFKYPMDRWGQGTSVT
VSSAATTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVL
KSDLYTLSSSVTVPSSVWPSETVTCNVAHPASSTTVDKKIVPRDC

Ligands and cofactors

ID	Name	Formula	Copies
IPA	Isopropyl alcohol	C3 H8 O	1

Water and common crystallization additives (SO4, TRS) are not listed.

Primary citation

Neutralization of NGF-TrkA Receptor Interaction by the Novel Antagonistic anti-TrkA Monoclonal Antibody MNAC13: a Structural Insight. Covaceuszach, S., Cattaneo, A., Lamba, D. Proteins (2005) 58:717-727. DOI 10.1002/prot.20366 · PubMed

Other PDB entries of the same protein (UniProt P01837 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3D9A 1.2 Å, High Resolution Crystal Structure Structure of HyHel10 Fab Complexed to Hen Egg Lysozyme
1RUR 1.5 Å, Crystal Structure (I) of native Diels-Alder antibody 13G5 Fab at pH 8.0 with a data set…
2AJU 1.5 Å, Cyrstal structure of cocaine catalytic antibody 7A1 Fab'
2AJV 1.5 Å, Crystal Structure of Cocaine catalytic Antibody 7A1 Fab' in Complex with Cocaine
2W60 1.5 Å, Anti citrullinated Collagen type 2 antibody acc4
2W9D 1.57 Å, Structure of Fab fragment of the ICSM 18 - anti-Prp therapeutic antibody at 1.57 A…
3BKJ 1.59 Å, Crystal structure of Fab wo2 bound to the n terminal domain of amyloid beta peptide (1-16)
3BAE 1.59 Å, Crystal structure of Fab WO2 bound to the N terminal domain of Amyloid beta peptide (1-28)
2R1Y 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
2R2B 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
3BKM 1.6 Å, Structure of anti-amyloid-beta Fab WO2 (Form A, P212121)
3CFB 1.6 Å, High-resolution structure of blue fluorescent antibody EP2-19G2 in complex with stilbene…

Browse structure collections

About this viewer

MolViewer shows 1SEQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.