Fab MNAC13. Determined by X-ray diffraction at 1.78 Å resolution. Released 1 Mar 2005.
Explore 1SEQ in 3D Show helices and sheets RCSB PDB PDBe
1SEQ contains 16 α-helices and 45 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 6 |
| β-strand | 10-12 | 3 | 7 |
| β-strand | 18-25 | 8 | 6 |
| α-helix | 29-31 | 3 | |
| β-strand | 34-39 | 6 | 7 |
| β-strand | 45-51 | 7 | 7 |
| β-strand | 57-58 | 2 | 7 |
| β-strand | 67-72 | 6 | 6 |
| α-helix | 73-75 | 3 | |
| β-strand | 77-82 | 6 | 6 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-94 | 7 | 7 |
| β-strand | 97-99 | 3 | 8 |
| β-strand | 100B-100D | 3 | 8 |
| α-helix | 100E | 1 | |
| β-strand | 101 | 1 | 7 |
| β-strand | 107-111 | 5 | 7 |
| α-helix | 115-116 | 2 | |
| β-strand | 117 | 1 | 9 |
| β-strand | 120-124 | 5 | 10 |
| β-strand | 135-145 | 11 | 10 |
| β-strand | 146 | 1 | 9 |
| β-strand | 151-154 | 4 | 11 |
| α-helix | 155-157 | 3 | |
| β-strand | 159 | 1 | 11 |
| β-strand | 163-165 | 3 | 10 |
| α-helix | 166-168 | 3 | |
| β-strand | 169-171 | 3 | 10 |
| β-strand | 174-184 | 11 | 10 |
| β-strand | 194-199 | 6 | 11 |
| α-helix | 200-202 | 3 | |
| β-strand | 204-209 | 6 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-5 | 2 | 1 |
| β-strand | 10-13 | 4 | 2 |
| β-strand | 19-25 | 7 | 1 |
| β-strand | 34-38 | 5 | 2 |
| β-strand | 45-49 | 5 | 2 |
| β-strand | 53-54 | 2 | 2 |
| α-helix | 55 | 1 | |
| β-strand | 62-67 | 6 | 1 |
| β-strand | 70-75 | 6 | 1 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-90 | 7 | 2 |
| α-helix | 96 | 1 | |
| β-strand | 97-98 | 2 | 2 |
| β-strand | 102-106 | 5 | 2 |
| α-helix | 106A | 1 | |
| β-strand | 110 | 1 | 3 |
| β-strand | 113-117 | 5 | 4 |
| α-helix | 118-120 | 3 | |
| α-helix | 121-125 | 5 | |
| β-strand | 128-138 | 11 | 4 |
| β-strand | 139 | 1 | 3 |
| β-strand | 144-149 | 6 | 5 |
| β-strand | 152-154 | 3 | 5 |
| β-strand | 158-162 | 5 | 4 |
| α-helix | 163-166 | 4 | |
| β-strand | 172-181 | 10 | 4 |
| α-helix | 182-186 | 5 | |
| β-strand | 190-196 | 7 | 5 |
| β-strand | 204-209 | 6 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Monoclonal Antibody MNAC13 | L | protein | 213 | Mus musculus | P01837 (AlphaFold model) |
| Monoclonal Antibody MNAC13 | H | protein | 225 | Mus musculus | P01868 (AlphaFold model) |
>1SEQ_1 Monoclonal Antibody MNAC13 (chains L) DIVLTQSPAIMSASLGSSVTLTCSASSSVSYMHWYQQKSGTSPVLLIYTTSNLASGVPSR FSGSGSGTFYSLTISSVEASDAADYYCHQWSSYPWTFGGGTKLEIKRADAAPTVSIFPPS SEQLTSGGASVVCFLNNFYPKSINSKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTL TKNEYERHNSYTCEATHKTSTSPIVKSFNRSEC
>1SEQ_2 Monoclonal Antibody MNAC13 (chains H) EVKLVESGGGLVQPGGSLKLSCAASGFTFSTYTMSWARQTPEKKLEWVAYISKGGGSTYY PDTVKGRFTISRDNAKNTLYLQMSSLKSEDTALYYCARGAMFGNDFKYPMDRWGQGTSVT VSSAATTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVL KSDLYTLSSSVTVPSSVWPSETVTCNVAHPASSTTVDKKIVPRDC
| ID | Name | Formula | Copies |
|---|---|---|---|
| IPA | Isopropyl alcohol | C3 H8 O | 1 |
Water and common crystallization additives (SO4, TRS) are not listed.
Neutralization of NGF-TrkA Receptor Interaction by the Novel Antagonistic anti-TrkA Monoclonal Antibody MNAC13: a Structural Insight. Covaceuszach, S., Cattaneo, A., Lamba, D. Proteins (2005) 58:717-727. DOI 10.1002/prot.20366 · PubMed
Other PDB entries of the same protein (UniProt P01837 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1SEQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.