1SFC: Neuronal synaptic fusion complex
Neuronal synaptic fusion complex. Determined by X-ray diffraction at 2.4 Å resolution. Released 28 Oct 1998.
- Method
- X-ray diffraction
- Resolution
- 2.4 Å
- Organism
- Rattus norvegicus
- Chains
- 12
- Atoms
- 7,105
- Mol. weight
- 120.95 kDa
- Ligands
- SR
- Released
- 28 Oct 1998
Explore 1SFC in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
1SFC contains 12 α-helices and 0 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chains A and I: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 30-91 | 62 | |
Chain B: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 191-256 | 66 | |
Chain C: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-81 | 74 | |
Chain D: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 141-201 | 61 | |
Chain E: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 30-94 | 65 | |
Chain F: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 192-260 | 69 | |
Chain G: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 17-80 | 64 | |
Chain H: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 142-202 | 61 | |
3 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Protein (synaptobrevin 2) | A, E, I | protein | 96 | Rattus norvegicus | P63045 (AlphaFold model) |
| Protein (syntaxin 1A) | B, F, J | protein | 83 | Rattus norvegicus | P32851 (AlphaFold model) |
| Protein (snap-25B) | C, G, K | protein | 83 | Rattus norvegicus | P60881 (AlphaFold model) |
| Protein (snap-25B) | D, H, L | protein | 87 | Rattus norvegicus | P60881 (AlphaFold model) |
Sequence of entity 1 (A, E, I), FASTA
>1SFC_1 PROTEIN (SYNAPTOBREVIN 2) (chains A, E, I)
MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKL
SELDDRADALQAGASQFETSAAKLKRKYWWKNLKMM
Sequence of entity 2 (B, F, J), FASTA
>1SFC_2 PROTEIN (SYNTAXIN 1A) (chains B, F, J)
GIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEH
AVDYVERAVSDTKKAVKYQSKAR
Sequence of entity 3 (C, G, K), FASTA
>1SFC_3 PROTEIN (SNAP-25B) (chains C, G, K)
MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRV
EEGMNHINQDMKEAEKNLKDLGK
Sequence of entity 4 (D, H, L), FASTA
>1SFC_4 PROTEIN (SNAP-25B) (chains D, H, L)
VVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQID
RIMEKADSNKTRIDEANQRATKMLGSG
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| SR | Strontium ion | Sr | 13 |
Water and common crystallization additives (MPD) are not listed.
Primary citation
Crystal structure of a SNARE complex involved in synaptic exocytosis at 2.4 A resolution. Sutton, R.B., Fasshauer, D., Jahn, R. et al. Nature (1998) 395:347-353. DOI 10.1038/26412 · PubMed
Other PDB entries of the same protein (UniProt P63045 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1N7S 1.45 Å, High Resolution Structure of a Truncated Neuronal SNARE Complex
- 5W5C 1.85 Å, Crystal structure of the primed SNARE-Complexin-Synaptotagmin-1 C2AB complex
- 6WVW 2.11 Å, Crystal structure of the R59P-SNAP25 containing SNARE complex
- 1KIL 2.3 Å, Three-dimensional structure of the complexin/SNARE complex
- 5W5D 2.5 Å, Crystal structure of the primed SNARE-Complexin-Synaptotagmin-1 C2B complex
- 6A30 2.79 Å, Crystal Structure of Munc13-1 MUN Domain and Synaptobrevin-2 Juxtamembrane Linker Region
- 3HD7 3.4 Å, Helical extension of the neuronal snare complex into the membrane, spacegroup C 1 2 1
- 5CCG 3.5 Å, Structure of the Ca2+-bound synaptotagmin-1 SNARE complex (long unit cell form)
- 7UDB 3.5 Å, Cryo-EM structure of a synaptobrevin-Munc18-1-syntaxin-1 complex class 2
- 5CCH 3.6 Å, Structure of the Ca2+-bound synaptotagmin-1 SNARE complex (short unit cell form)
- 6IP1 3.9 Å, alpha-SNAP-SNARE subcomplex in the whole 20S complex
- 5CCI 4.1 Å, Structure of the Mg2+-bound synaptotagmin-1 SNARE complex (short unit cell form)
Browse more
1SFC is part of these collections:
About this viewer
MolViewer shows 1SFC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.