1SKO: MP1-p14 Complex

MP1-p14 Complex. Determined by X-ray diffraction at 2.0 Å resolution. Released 1 Jun 2004.

Method: X-ray diffraction
Resolution: 2.0 Å
Organisms: Homo sapiens, Mus musculus
Chains: 2
Atoms: 2,032
Mol. weight: 30.15 kDa
Released: 1 Jun 2004

Explore 1SKO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1SKO contains 8 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	2-13	12
α-helix	14-16	3
β-strand	20-26	7	1
β-strand	32-37	6	1
α-helix	43-46	4
α-helix	48-61	14
β-strand	69-76	8	1
β-strand	79-86	8	1
β-strand	89-96	8	1
α-helix	101-116	16

Chain B: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	5-12	8
β-strand	18-24	7	1
β-strand	30-35	6	1
α-helix	41-56	16
β-strand	68-75	8	1
β-strand	78-85	8	1
β-strand	88-94	7	1
α-helix	100-114	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitogen-activated protein kinase kinase 1 interacting protein 1	A	protein	143	Homo sapiens	Q9UHA4 (AlphaFold model)
Late endosomal/lysosomal Mp1 interacting protein	B	protein	130	Mus musculus	Q9JHS3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1SKO_1 Mitogen-activated protein kinase kinase 1 interacting protein 1 (chains A)
MGSSHHHHHHHHENLYFQGSADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAP
EHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTG
LIVSLEKELAPLFEELRQVVEVS

Sequence of entity 2 (B), FASTA

>1SKO_2 Late endosomal/lysosomal Mp1 interacting protein (chains B)
MHHHHHHLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWA
AYDRNGNQAFNEDSLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQY
LEEPLTQVAA

Primary citation

The structure of the MAP kinase scaffold MP1 bound to its partner p14: a complex with a critical role in endosomal MAP kinase signaling. Lunin, V.V., Munger, C., Wagner, J. et al. J Biol Chem (2004) 279:23422-23430. DOI 10.1074/jbc.M401648200 · PubMed

Other PDB entries of the same protein (UniProt Q9UHA4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6B9X 1.42 Å, Crystal structure of Ragulator
3CPT 1.9 Å, MP1-p14 Scaffolding complex
2ZL1 2.0 Å, MP1-p14 Scaffolding complex
5X6V 2.02 Å, Crystal structure of human heteroheptameric complex
6EHP 2.3 Å, The crystal structure of the human LAMTOR complex
5X6U 2.4 Å, Crystal structure of human heteropentameric complex
5Y39 2.65 Å, Crystal structure of Ragulator complex (p18 76-145)
6EHR 2.9 Å, The crystal structure of the human LAMTOR-RagA CTD-RagC CTD complex
5Y3A 2.9 Å, Crystal structure of Ragulator complex (p18 49-161)
7UX2 2.9 Å, cryo-EM structure of the Raptor-TFEB-Rag-Ragulator complex
5YK3 3.01 Å, human Ragulator complex
6U62 3.18 Å, Raptor-Rag-Ragulator complex

Browse structure collections

About this viewer

MolViewer shows 1SKO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.