1T9P: V44A, G45P Cp Rubredoxin

Crystal Structure of V44A, G45P Cp Rubredoxin. Determined by X-ray diffraction at 1.5 Å resolution. Released 5 Oct 2004.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Clostridium pasteurianum
Chains: 3
Atoms: 1,402
Mol. weight: 18.36 kDa
Ligands: FE
Released: 5 Oct 2004

Explore 1T9P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1T9P contains 9 α-helices and 21 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	1
β-strand	12-13	2	1
β-strand	19	1	2
α-helix	20-22	3
β-strand	24	1	2
α-helix	30-32	3
β-strand	38	1	3
β-strand	45	1	3
α-helix	46-48	3
β-strand	49-51	3	1

Chain B: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	104-106	3	4
β-strand	112-113	2	4
β-strand	119	1	5
α-helix	120-122	3
β-strand	124	1	5
α-helix	130-132	3
β-strand	138	1	6
β-strand	145	1	6
α-helix	146-148	3
β-strand	149-151	3	4

Chain C: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	204-206	3	7
β-strand	212-213	2	7
β-strand	219	1	8
α-helix	220-222	3
β-strand	224	1	8
α-helix	230-232	3
β-strand	238	1	9
β-strand	245	1	9
α-helix	246-248	3
β-strand	249-251	3	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Rubredoxin	A, B, C	protein	54	Clostridium pasteurianum	P00268 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>1T9P_1 Rubredoxin (chains A, B, C)
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGAPKDQFEEVEE

Ligands and cofactors

ID	Name	Formula	Copies
FE	FE (III) ion	Fe	3

Primary citation

Crystallographic studies of V44 mutants of Clostridium pasteurianum rubredoxin: Effects of side-chain size on reduction potential. Park, I.Y., Eidsness, M.K., Lin, I.J. et al. Proteins (2004) 57:618-625. DOI 10.1002/prot.20243 · PubMed

Other PDB entries of the same protein (UniProt P00268 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2PVE 0.79 Å, NMR and X-ray Analysis of Structural Additivity in Metal Binding Site-Swapped Hybrids of…
1IRO 1.1 Å, Rubredoxin (oxidized, fe(iii)) at 1.1 Å resolution
1IRN 1.2 Å, Rubredoxin (ZN-substituted) at 1.2 Å resolution
4RXN 1.2 Å, Crystallographic refinement of rubredoxin at 1.2 Å resolution
5RXN 1.2 Å, Combined crystallographic refinement and energy minimization of rubredoxin at 1.2 Å…
1SMM 1.36 Å, Crystal Structure of Cp Rd L41A mutant in oxidized state
1SMW 1.38 Å, Crystal Structure of Cp Rd L41A mutant in reduced state 2 (soaked)
1SMU 1.43 Å, Crystal Structure of Cp Rd L41A mutant in reduced state 1 (drop-reduced)
1B13 1.5 Å, Clostridium pasteurianum rubredoxin G10A mutant
1FHH 1.5 Å, X-ray crystal structure of oxidized rubredoxin
1FHM 1.5 Å, X-ray crystal structure of reduced rubredoxin
1R0I 1.5 Å, cadmium-substituted rubredoxin

Browse structure collections

About this viewer

MolViewer shows 1T9P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.