1SVZ: Single-chain Fv fragment 1696

Crystal structure of the single-chain Fv fragment 1696 in complex with the epitope peptide corresponding to N-terminus of HIV-2 protease. Determined by X-ray diffraction at 1.89 Å resolution. Released 1 Mar 2005.

Method: X-ray diffraction
Resolution: 1.89 Å
Organism: Mus musculus
Chains: 4
Atoms: 4,146
Mol. weight: 55.88 kDa
Released: 1 Mar 2005

Explore 1SVZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1SVZ contains 16 α-helices and 47 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	30	1	3
β-strand	36	1	3
β-strand	38-43	6	2
β-strand	49-54	6	2
β-strand	58-59	2	2
α-helix	60	1
β-strand	67-72	6	1
β-strand	75-80	6	1
α-helix	85-87	3
β-strand	89-95	7	2
α-helix	101	1
β-strand	102-103	2	2
β-strand	107-111	5	2
β-strand	130-133	4	4
α-helix	134-136	3
β-strand	137-139	3	5
β-strand	145-152	8	4
α-helix	156-158	3
β-strand	161-166	6	5
β-strand	172-178	7	5
β-strand	185-187	3	5
α-helix	189-191	3
β-strand	195-200	6	4
α-helix	201-203	3
β-strand	205-210	6	4
α-helix	215-217	3
β-strand	219-227	9	5
α-helix	228-230	3
β-strand	232-237	6	5
β-strand	241-245	5	5

Chain B: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	6
β-strand	10-13	4	7
β-strand	19-25	7	6
β-strand	38-43	6	7
β-strand	50-54	5	7
β-strand	58-59	2	7
α-helix	60	1
β-strand	67-72	6	6
β-strand	75-80	6	6
α-helix	85-87	3
β-strand	89-95	7	7
α-helix	101	1
β-strand	102-103	2	7
β-strand	107-111	5	7
β-strand	130-133	4	8
β-strand	137-139	3	9
β-strand	145-152	8	8
β-strand	161-166	6	7
β-strand	172-178	7	7
β-strand	185-187	3	7
α-helix	189-191	3
β-strand	195-200	6	8
α-helix	201-203	3
β-strand	205-210	6	8
α-helix	215-217	3
β-strand	220-227	8	7
α-helix	228-230	3
β-strand	232-237	6	7
β-strand	241-242	2	7
β-strand	243-245	3	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
single-chain Fv fragment 1696	A, B	protein	247	Mus musculus	P01631 (AlphaFold model)
epitope peptide corresponding to N-terminus of HIV-2 protease	C, D	protein	8

Sequence of entity 1 (A, B), FASTA

>1SVZ_1 single-chain Fv fragment 1696 (chains A, B)
DILMTQTPLYLPVSLGDQASISCRSSQTIVHNNGNTYLEWYLQKPGQSPQLLIYKVSNRF
SGVPDRFSGSGSGTDFTLKISRVEAEDLGIYYCFQGSHFPPTFGGGTKLEIKGGGGSGGG
GSGGGGSEVQLQQSGPELKKPGETVKISCKATNYAFTDYSMHWVKQAPGGDLKYVGWINT
ETDEPTFADDFKGRFAFSLDTSTSTAFLQINNLKNEDTATYFCVRDRHDYGEIFTYWGQG
TTVTVSS

Sequence of entity 2 (C, D), FASTA

>1SVZ_2 epitope peptide corresponding to N-terminus of HIV-2 protease (chains C, D)
PQFSLWKR

Primary citation

Crystal structure of a cross-reaction complex between an anti-HIV-1 protease antibody and an HIV-2 protease peptide. Rezacova, P., Brynda, J., Lescar, J. et al. J Struct Biol (2005) 149:332-337. DOI 10.1016/j.jsb.2004.11.009 · PubMed

Other PDB entries of the same protein (UniProt P01631 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1DLF 1.45 Å, High resolution crystal structure of the fv fragment from an anti-dansyl switch variant…
2DLF 1.55 Å, High resolution crystal structure of the fv fragment from an anti-dansyl switch variant…
1N4X 1.7 Å, Structure of scFv 1696 at acidic pH
1WZ1 1.85 Å, Crystal structure of the Fv fragment complexed with dansyl-lysine
2IPT 2.0 Å, PFA1 Fab Fragment
2IQA 2.0 Å, PFA2 FAB fragment, monoclinic apo form
2HKF 2.01 Å, Crystal structure of the Complex Fab M75- Peptide
2O5X 2.05 Å, Crystal structure of 1E9 LeuH47Trp/ArgH100Trp, an engineered Diels-Alderase Fab with nM…
1BFV 2.1 Å, Monoclonal antibody fragment FV4155 from E. Coli
1CFV 2.1 Å, Monoclonal antibody fragment FV4155 from E. Coli
2HKH 2.1 Å, Crystal structure of the Fab M75
2O5Z 2.4 Å, Crystal structure of the 1E9 LeuH47Trp/ArgH100Trp Fab 5-beta-androstane-3,17-dione complex

Browse structure collections

About this viewer

MolViewer shows 1SVZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.