1SZB: Human MBL-associated protein 19

Crystal structure of the human MBL-associated protein 19 (MAp19). Determined by X-ray diffraction at 2.5 Å resolution. Released 22 Jun 2004.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,789
Mol. weight: 38.38 kDa
Ligands: CA
Released: 22 Jun 2004

Explore 1SZB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1SZB contains 4 α-helices and 27 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	7-9	3
β-strand	12-16	5	1
β-strand	29-35	7	2
β-strand	40-50	11	1
β-strand	61-65	5	2
β-strand	70-74	5	2
β-strand	77	1	1
β-strand	91-92	2	1
β-strand	97-103	7	2
β-strand	114-123	10	1
α-helix	134-135	2
β-strand	140-144	5	3
β-strand	147-151	5	3
β-strand	156-158	3	4
β-strand	165-167	3	4

Chain B: 2 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	12-16	5	5
α-helix	23-25	3
β-strand	29-35	7	6
β-strand	41-50	10	5
β-strand	61-66	6	6
β-strand	69-74	6	6
β-strand	80	1	7
β-strand	83	1	7
β-strand	91-92	2	5
β-strand	97-103	7	6
β-strand	114-122	9	5
α-helix	134-135	2
β-strand	140-144	5	8
β-strand	147-151	5	8
β-strand	156-158	3	9
β-strand	165-167	3	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
mannose binding lectin-associated serine protease-2 related protein, MAp19 (19kDa)	A, B	protein	170	Homo sapiens	O00187 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1SZB_1 mannose binding lectin-associated serine protease-2 related protein, MAp19 (19kDa) (chains A, B)
TPLGPKWPEPVFGRLASPGFPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYD
FVKLSSGAKVLATLCGQESTDTERAPGKDTFYSLGSSLDITFRSDYSNEKPFTGFEAFYA
AEDIDECQVAPGEAPTCDHHCHNHLGGFYCSCRAGYVLHRNKRTCSEQSL

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4

Primary citation

The X-ray structure of human MBL-associated protein 19 (MAp19) and its interaction site with mannan-binding lectin and L-ficolin. Gregory, L.A., Thielens, N.M., Matsushita, M. et al. J Biol Chem (2004) 279:29391-29397. DOI 10.1074/jbc.M402687200 · PubMed

Other PDB entries of the same protein (UniProt O00187 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3TVJ 1.28 Å, Catalytic fragment of MASP-2 in complex with its specific inhibitor developed by…
9D40 1.76 Å, Crystal structure of the catalytic region of human MASP-2 with specific inhibitor Analog…
9D17 1.97 Å, Crystal structure of the catalytic region of human MASP-2 with specific inhibitor…
9D3Y 2.08 Å, Crystal structure of the catalytic region of human MASP-2 with specific inhibitor…
1ZJK 2.18 Å, Crystal structure of the zymogen catalytic region of human MASP-2
1Q3X 2.23 Å, Crystal structure of the catalytic region of human MASP-2
9D4D 2.36 Å, Crystal structure of the catalytic region of human MASP-2 with specific inhibitor…
7PQN 2.4 Å, Catalytic fragment of MASP-2 in complex with ecotin
5JPM 3.75 Å, Structure of the complex of human complement C4 with MASP-2 rebuilt using iMDFF

Browse structure collections

About this viewer

MolViewer shows 1SZB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.