Crystal structure of the catalytic region of human MASP-2 with specific inhibitor Compound S3. Determined by X-ray diffraction at 2.36 Å resolution. Released 16 Apr 2025.
Explore 9D4D in 3D Show helices and sheets RCSB PDB PDBe
9D4D contains 13 α-helices and 28 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 365 | 1 | 1 |
| α-helix | 369-372 | 4 | |
| β-strand | 375-379 | 5 | 2 |
| β-strand | 387 | 1 | 1 |
| β-strand | 391-396 | 6 | 2 |
| β-strand | 401-404 | 4 | 3 |
| β-strand | 409-412 | 4 | 2 |
| β-strand | 418-420 | 3 | 2 |
| α-helix | 427-428 | 2 | |
| β-strand | 429-432 | 4 | 3 |
| α-helix | 433 | 1 | |
| β-strand | 446 | 1 | 4 |
| β-strand | 449-450 | 2 | 5 |
| α-helix | 451-452 | 2 | |
| β-strand | 459-463 | 5 | 6 |
| β-strand | 468-473 | 6 | 6 |
| β-strand | 477-480 | 4 | 6 |
| α-helix | 482-489 | 8 | |
| β-strand | 496-499 | 4 | 6 |
| β-strand | 503 | 1 | 7 |
| β-strand | 510-519 | 10 | 6 |
| β-strand | 534-538 | 5 | 6 |
| α-helix | 541-544 | 4 | |
| α-helix | 550-551 | 2 | |
| β-strand | 552 | 1 | 5 |
| α-helix | 553-554 | 2 | |
| α-helix | 556-561 | 6 | |
| β-strand | 567-572 | 6 | 5 |
| β-strand | 575 | 1 | 8 |
| β-strand | 581 | 1 | 8 |
| β-strand | 584 | 1 | 7 |
| β-strand | 586-592 | 7 | 5 |
| α-helix | 595-601 | 7 | |
| α-helix | 608 | 1 | |
| β-strand | 616-619 | 4 | 5 |
| β-strand | 627 | 1 | 4 |
| β-strand | 636-641 | 6 | 5 |
| β-strand | 646-655 | 10 | 5 |
| β-strand | 667-671 | 5 | 5 |
| α-helix | 672-675 | 4 | |
| α-helix | 676-685 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Mannan-binding lectin serine protease 2 B chain | A | protein | 324 | Homo sapiens | O00187 (AlphaFold model) |
>9D4D_1 Mannan-binding lectin serine protease 2 B chain (chains A) IVDCGPPDDLPSGRVEYITGPGVTTYKAVIQYSCEETFYTMKVNDGKYVCEADGFWTSSK GEKSLPVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLILGGTTAAGALLYDNWVLTAA HAVYEQKHDASALDIRMGTLKRLSPHYTQAWSEAVFIHEGYTHDAGFDNDIALIKLNNKV VINSNITPICLPRKEAESFMRTDDIGTASGWGLTQRGFLARNLMYVDIPIVDHQKCTAAY EKPPYPRGSVTANMLCAGLESGGKDSCRGDSGGALVFLDSETERWFVGGIVSWGSMNCGE AGQYGVYTKVINYIPWIENIISDF
| ID | Name | Formula | Copies |
|---|---|---|---|
| A1A10 | 2-(2-amino-1H-1,3-benzimidazol-4-yl)-N-{4-[(pyridin-4-yl)methyl]phenyl}acetamide | C21 H19 N5 O | 1 |
Water and common crystallization additives (GOL) are not listed.
Small molecule inhibitors of mannan-binding lectin-associated serine Proteases-2 and-3. Nakhla, M.C., Comita, J., Shapiro, A.B. et al. Eur J Med Chem (2025) 289:117238-117238. DOI 10.1016/j.ejmech.2025.117238 · PubMed
Other PDB entries of the same protein (UniProt O00187 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9D4D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.