1T0J: Voltage-gated calcium channel subunit beta2a

Crystal structure of a complex between voltage-gated calcium channel beta2a subunit and a peptide of the alpha1c subunit. Determined by X-ray diffraction at 2.0 Å resolution. Released 15 Jun 2004.

Method: X-ray diffraction
Resolution: 2.0 Å
Organisms: Rattus norvegicus, Homo sapiens
Chains: 3
Atoms: 2,506
Mol. weight: 42.66 kDa
Released: 15 Jun 2004

Explore 1T0J in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1T0J contains 15 α-helices and 13 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	44-55	12
β-strand	62-66	5	1
β-strand	70	1	2
α-helix	74-76	3
β-strand	84	1	1
β-strand	87	1	2
β-strand	92-100	9	1
β-strand	103-108	6	1
β-strand	116-119	4	1
α-helix	121-135	15

Chain B: 11 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	220-223	4	1
α-helix	227-228	2
β-strand	229-232	4	3
α-helix	240-256	17
β-strand	261-266	6	3
α-helix	270-272	3
α-helix	286-288	3
α-helix	296-310	15
β-strand	315-320	6	3
α-helix	326-328	3
β-strand	337-341	5	3
α-helix	346-355	10
α-helix	364-375	12
α-helix	379-382	4
β-strand	385-387	3	3
α-helix	392-410	19
α-helix	413-415	3

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	429-442	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
voltage-gated calcium channel subunit beta2a	A	protein	132	Rattus norvegicus	Q8VGC3 (AlphaFold model)
voltage-gated calcium channel subunit beta2a	B	protein	224	Rattus norvegicus	Q8VGC3 (AlphaFold model)
Voltage-dependent L-type calcium channel alpha-1C subunit	C	protein	20	Homo sapiens	Q13936 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1T0J_1 voltage-gated calcium channel subunit beta2a (chains A)
GHMGSADSYTSRPSDSDVSLEEDREAVRREAERQAQAQLEKAKTKPVAFAVRTNVRYSAA
QEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQ
RAKQGKFYSSKS

Sequence of entity 2 (B), FASTA

>1T0J_2 voltage-gated calcium channel subunit beta2a (chains B)
MSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRI
SITRVTADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQSEIERIFELARTLQLVVLDAD
TINHPAQLSKTSLAPIIVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPQE
SFDVILDENQLEDACEHLADYLEAYWKATHPPSSNLPNPLLSRT

Sequence of entity 3 (C), FASTA

>1T0J_3 Voltage-dependent L-type calcium channel alpha-1C subunit (chains C)
GAQQLEEDLKGYLDWITQAE

Primary citation

Structure of a complex between a voltage-gated calcium channel beta-subunit and an alpha-subunit domain. Van Petegem, F., Clark, K.A., Chatelain, F.C. et al. Nature (2004) 429:671-675. DOI 10.1038/nature02588 · PubMed

Other PDB entries of the same protein (UniProt Q8VGC3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5V2Q 1.7 Å, CaV beta2a subunit: CaV1.2 AID-CEN complex
1T0H 1.97 Å, Crystal structure of the Rattus norvegicus voltage gated calcium channel beta subunit…
5V2P 2.0 Å, CaV beta2a subunit: CaV1.2 AID-CAP complex
3JBR 4.2 Å, Cryo-EM structure of the rabbit voltage-gated calcium channel Cav1.1 complex at 4.2…

Browse structure collections

About this viewer

MolViewer shows 1T0J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.