1T15: Brca1 BRCT Domains

Crystal Structure of the Brca1 BRCT Domains in Complex with the Phosphorylated Interacting Region from Bach1 Helicase. Determined by X-ray diffraction at 1.85 Å resolution. Released 11 May 2004.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,906
Mol. weight: 25.49 kDa
Released: 11 May 2004

Explore 1T15 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1T15 contains 13 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	1651-1655	5	1
α-helix	1659-1672	14
β-strand	1675-1676	2	1
β-strand	1686-1689	4	1
β-strand	1691	1	2
β-strand	1696-1697	2	2
β-strand	1700	1	3
α-helix	1701-1708	8
β-strand	1712-1715	4	1
α-helix	1717-1724	8
α-helix	1731-1734	4
β-strand	1735	1	1
β-strand	1738-1739	2	2
β-strand	1743	1	2
α-helix	1748-1753	6
β-strand	1765-1768	4	4
α-helix	1777-1786	10
α-helix	1789	1
β-strand	1790-1791	2	4
α-helix	1795-1797	3
α-helix	1798-1800	3
β-strand	1806-1810	5	4
α-helix	1812-1814	3
α-helix	1819-1822	4
β-strand	1832-1834	3	4
α-helix	1835-1844	10
α-helix	1851-1853	3
β-strand	1854	1	4

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	10	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Breast cancer type 1 susceptibility protein	A	protein	214	Homo sapiens	P38398 (AlphaFold model)
BRCA1 interacting protein C-terminal helicase 1	B	protein	8		Q9BX63 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1T15_1 Breast cancer type 1 susceptibility protein (chains A)
VNKRMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFVCERTLKYFL
GIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLE
ICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWTEDNGFHAIG
QMCEAPVVTREWVLDSVALYQCQELDTYLIPQIP

Sequence of entity 2 (B), FASTA

>1T15_2 BRCA1 interacting protein C-terminal helicase 1 (chains B)
STSPTFNK

Primary citation

Structure and mechanism of BRCA1 BRCT domain recognition of phosphorylated BACH1 with implications for cancer. Clapperton, J.A., Manke, I.A., Lowery, D.M. et al. Nat Struct Mol Biol (2004) 11:512-518. DOI 10.1038/nsmb775 · PubMed

Other PDB entries of the same protein (UniProt P38398 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8RS8 1.31 Å, Crystal structure of BRCA1 BRCTs in complex with a RIF1 phosphopeptide
4IGK 1.75 Å, Structure of human BRCA1 BRCT in complex with ATRIP peptide
4IFI 2.2 Å, Structure of human BRCA1 BRCT in complex with BAAT peptide
1T29 2.3 Å, Crystal structure of the BRCA1 BRCT repeats bound to a phosphorylated BACH1 peptide
1JNX 2.5 Å, Crystal structure of the BRCT repeat region from the breast cancer associated protein,…
1Y98 2.5 Å, Structure of the BRCT repeats of BRCA1 bound to a CtIP phosphopeptide.
3PXB 2.5 Å, Impact of BRCA1 BRCT domain missense substitutions on phospho-peptide recognition: T1700A
4Y2G 2.5 Å, Structure of BRCA1 BRCT domains in complex with Abraxas single phosphorylated peptide
3PXA 2.55 Å, Impact of BRCA1 BRCT domain missense substitutions on phospho-peptide recognition: G1656D
3K0H 2.7 Å, The crystal structure of BRCA1 BRCT in complex with a minimal recognition tetrapeptide…
3K0K 2.7 Å, Crystal Structure of BRCA1 BRCT in complex with a minimal recognition tetrapeptide with…
1N5O 2.8 Å, Structural consequences of a cancer-causing BRCA1-BRCT missense mutation

Browse structure collections

About this viewer

MolViewer shows 1T15 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.