1T29: BRCA1 BRCT repeats

Crystal structure of the BRCA1 BRCT repeats bound to a phosphorylated BACH1 peptide. Determined by X-ray diffraction at 2.3 Å resolution. Released 11 May 2004.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,009
Mol. weight: 26.21 kDa
Released: 11 May 2004

Explore 1T29 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1T29 contains 12 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	1651-1655	5	1
α-helix	1659-1672	14
β-strand	1675-1677	3	1
β-strand	1686-1689	4	1
β-strand	1696-1697	2	2
α-helix	1701-1708	8
β-strand	1712-1715	4	1
α-helix	1717-1724	8
α-helix	1731-1734	4
β-strand	1735	1	1
β-strand	1738-1739	2	2
β-strand	1743	1	2
α-helix	1748-1754	7
β-strand	1764-1768	5	3
α-helix	1777-1786	10
β-strand	1790-1791	2	3
α-helix	1795-1797	3
β-strand	1805-1810	6	3
α-helix	1812-1814	3
α-helix	1825-1827	3
β-strand	1832-1834	3	3
α-helix	1836-1844	9
α-helix	1847-1849	3
α-helix	1851-1853	3
β-strand	1854	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Breast cancer type 1 susceptibility protein	A	protein	214	Homo sapiens	P38398 (AlphaFold model)
BACH1 phosphorylated peptide	B	protein	14		Q9BX63 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1T29_1 Breast cancer type 1 susceptibility protein (chains A)
VNKRMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFVCERTLKYFL
GIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLE
ICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWTEDNGFHAIG
QMCEAPVVTREWVLDSVALYQCQELDTYLIPQIP

Sequence of entity 2 (B), FASTA

>1T29_2 BACH1 phosphorylated peptide (chains B)
ISRSTSPTFNKQTK

Primary citation

Structure of the BRCT repeats of BRCA1 bound to a BACH1 phosphopeptide: implications for signaling. Shiozaki, E.N., Gu, L., Yan, N. et al. Mol Cell (2004) 14:405-412. DOI 10.1016/S1097-2765(04)00238-2 · PubMed

Other PDB entries of the same protein (UniProt P38398 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8RS8 1.31 Å, Crystal structure of BRCA1 BRCTs in complex with a RIF1 phosphopeptide
4IGK 1.75 Å, Structure of human BRCA1 BRCT in complex with ATRIP peptide
1T15 1.85 Å, Crystal Structure of the Brca1 BRCT Domains in Complex with the Phosphorylated…
4IFI 2.2 Å, Structure of human BRCA1 BRCT in complex with BAAT peptide
1JNX 2.5 Å, Crystal structure of the BRCT repeat region from the breast cancer associated protein,…
1Y98 2.5 Å, Structure of the BRCT repeats of BRCA1 bound to a CtIP phosphopeptide.
3PXB 2.5 Å, Impact of BRCA1 BRCT domain missense substitutions on phospho-peptide recognition: T1700A
4Y2G 2.5 Å, Structure of BRCA1 BRCT domains in complex with Abraxas single phosphorylated peptide
3PXA 2.55 Å, Impact of BRCA1 BRCT domain missense substitutions on phospho-peptide recognition: G1656D
3K0H 2.7 Å, The crystal structure of BRCA1 BRCT in complex with a minimal recognition tetrapeptide…
3K0K 2.7 Å, Crystal Structure of BRCA1 BRCT in complex with a minimal recognition tetrapeptide with…
1N5O 2.8 Å, Structural consequences of a cancer-causing BRCA1-BRCT missense mutation

Browse structure collections

About this viewer

MolViewer shows 1T29 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.