1T1F: Native Antithrombin in its Monomeric Form

Crystal Structure of Native Antithrombin in its Monomeric Form. Determined by X-ray diffraction at 2.75 Å resolution. Released 4 Oct 2005.

Method: X-ray diffraction
Resolution: 2.75 Å
Organism: Homo sapiens
Chains: 3
Atoms: 10,296
Mol. weight: 154.52 kDa
Released: 4 Oct 2005

Explore 1T1F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1T1F contains 57 α-helices and 57 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B and C: 19 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	40-41	2
α-helix	46-69	24
β-strand	76-78	3	1
α-helix	80-90	11
α-helix	91-93	3
β-strand	95	1	2
α-helix	97-105	9
α-helix	108-110	3
α-helix	113-117	5
α-helix	119-131	13
β-strand	138-149	12	3
α-helix	156-165	10
β-strand	170-173	4	3
α-helix	179-193	15
α-helix	203	1
β-strand	213-224	12	3
β-strand	225	1	4
α-helix	228-230	3
α-helix	231-233	3
β-strand	235-240	6	1
β-strand	246-262	17	1
α-helix	264-266	3
β-strand	268-273	6	1
β-strand	274	1	4
β-strand	279-285	7	1
α-helix	292-298	7
α-helix	301-310	10
β-strand	312-321	10	1
β-strand	323-329	7	3
α-helix	332-337	6
α-helix	342-344	3
β-strand	364-375	12	3
β-strand	379-380	2	3
β-strand	391	1	1
α-helix	394-396	3
β-strand	402-403	2	1
β-strand	408-414	7	1
β-strand	419-426	8	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Antithrombin-III	A, B, C	protein	432	Homo sapiens	P01008 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>1T1F_1 Antithrombin-III (chains A, B, C)
HGSPVDICTAKPRDIPMNPMCIYRSPEKKATEDEGSEQKIPEATNRRVWELSKANSRFAT
TFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQQLMEVFKFDTISEKTSDQIH
FFFAKLNCRLYRKANKASKLVSANRLFGDKSLTFNETYQDISELVYGAKLQPLDFKENAE
QSRAAINKWVSNKTEGRITDVIPSEAINELTVLVLVNTIYFKGLWKSKFSPENTRKELFY
KADGESCSASMMYQEGKFRYRRVAEGTQVLELPFKGDDITMVLILPKPEKSLAKVEKELT
PEVLQEWLDELEEMMLCVHMPRFRIEDGFSLKEQLQDMGLVDLFSPEKSKLPGIVAEGRD
DLYVSDAFHKAFLEVNEEGSEAAASTAVVIAGRSLNPNRVCFKANRPFLVFIREVPLNTI
IFMGRVANPCVK

Primary citation

Crystal structure of monomeric native antithrombin reveals a novel reactive center loop conformation. Johnson, D.J.D., Langdown, J., Li, W. et al. J Biol Chem (2006) 281:35478-35486. DOI 10.1074/jbc.M607204200 · PubMed

Other PDB entries of the same protein (UniProt P01008 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3KCG 1.7 Å, Crystal structure of the antithrombin-factor IXa-pentasaccharide complex
2B5T 2.1 Å, 2.1 Angstrom structure of a nonproductive complex between antithrombin, synthetic…
1TB6 2.5 Å, 2.5A Crystal Structure of the Antithrombin-Thrombin-Heparin Ternary Complex
1E04 2.6 Å, Plasma beta antithrombin-III
1JVQ 2.6 Å, Crystal structure at 2.6A of the ternary complex between antithrombin, a P14-P8 reactive…
1NQ9 2.6 Å, Crystal Structure of Antithrombin in the Pentasaccharide-Bound Intermediate State
2ANT 2.6 Å, The 2.6 a structure of antithrombin indicates a conformational change at the heparin…
1E05 2.62 Å, Plasma alpha antithrombin-III
1OYH 2.62 Å, Crystal Structure of P13 Alanine Variant of Antithrombin
1R1L 2.7 Å, Structure of dimeric antithrombin complexed with a P14-P9 reactive loop peptide and an…
2BEH 2.7 Å, Crystal structure of antithrombin variant S137A/V317C/T401C with plasma latent…
1DZG 2.8 Å, N135Q-S380C-antithrombin-III

Browse structure collections

About this viewer

MolViewer shows 1T1F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.