1T39: PDB entry 1T39

Human O6-alkylguanine-DNA alkyltransferase covalently crosslinked to DNA. Determined by X-ray diffraction at 3.3 Å resolution. Released 13 Jul 2004.

Method: X-ray diffraction
Resolution: 3.3 Å
Organism: Homo sapiens
Chains: 6
Atoms: 3,360
Mol. weight: 56.66 kDa
Released: 13 Jul 2004

Explore 1T39 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1T39 contains 15 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	8-10	3	1
β-strand	13-15	3	2
β-strand	17-18	2	2
β-strand	20	1	3
β-strand	21-24	4	1
β-strand	27-28	2	1
β-strand	32	1	3
α-helix	57-71	15
α-helix	73-78	6
α-helix	87-90	4
α-helix	94-104	11
β-strand	112-113	2	4
α-helix	114-120	7
α-helix	128-135	8
β-strand	140	1	5
β-strand	143	1	5
β-strand	148-149	2	4
α-helix	162-173	12

Chain B: 8 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	8	1	6
β-strand	13-15	3	7
β-strand	17-18	2	7
β-strand	20	1	8
β-strand	23-24	2	6
β-strand	27-28	2	6
β-strand	32	1	8
α-helix	57-71	15
α-helix	73-78	6
α-helix	80-83	4
α-helix	87-90	4
α-helix	94-104	11
β-strand	112-113	2	9
α-helix	114-120	7
α-helix	127-135	9
β-strand	140	1	10
β-strand	143	1	10
β-strand	148-149	2	9
α-helix	162-173	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5'-D(GPCPCPAPTPGP(E1X)PCPTPAPGPTP*A)-3'	C, E	DNA	13
5'-d(tpapcptpapgpcpcpaptpgpgp*c)-3'	D, F	DNA	13
Methylated-DNA--protein-cysteine methyltransferase	A, B	protein	188	Homo sapiens	P16455 (AlphaFold model)

Sequence of entity 1 (C, E), FASTA

>1T39_1 5'-D(*GP*CP*CP*AP*TP*GP*(E1X)P*CP*TP*AP*GP*TP*A)-3' (chains C, E)
GCCATGACTAGTA

Sequence of entity 2 (D, F), FASTA

>1T39_2 5'-D(*TP*AP*CP*TP*AP*GP*CP*CP*AP*TP*GP*GP*C)-3' (chains D, F)
TACTAGCCATGGC

Sequence of entity 3 (A, B), FASTA

>1T39_3 Methylated-DNA--protein-cysteine methyltransferase (chains A, B)
MRGSHHHHHHGSMDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPA
PAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKF
GEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWL
LAHEGHRL

Primary citation

DNA binding and nucleotide flipping by the human DNA repair protein AGT. Daniels, D.S., Woo, T.T., Luu, K.X. et al. Nat Struct Mol Biol (2004) 11:714-720. DOI 10.1038/nsmb791 · PubMed

Other PDB entries of the same protein (UniProt P16455 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1QNT 1.9 Å, X-ray structure of human O6alkylguanine-DNA alkyltransferase
1EH6 2.0 Å, Human O6-alkylguanine-DNA alkyltransferase
1EH7 2.0 Å, Methylated human O6-alkylguanine-DNA alkyltransferase
9QF2 2.42 Å, Cryo-EM structure of the fully Coronin-1B-decorated actin filament in the ADP state.
1EH8 2.5 Å, Benzylated human O6-alkylguanine-DNA alkyltransferase
28OP 2.7 Å, Structure of the human inner kinetochore CCAN and CENP-C bound to DNA
9QEY 2.74 Å, Cryo-EM structure of the actin filament bound by a single Coronin-1B molecule.
9QFB 2.74 Å, Cryo-EM structure of the fully Coronin-1B-decorated actin filament in the ADP state.
9QFQ 2.76 Å, Cryo-EM structure of the cofilactin barbed end bound by AIP1
1YFH 3.01 Å, wt Human O6-Alkylguanine-DNA Alkyltransferase Bound To DNA Containing an Alkylated…
9DI0 3.1 Å, Cryo-EM structure of Kif18A bound to a microtubule
9QFE 3.12 Å, Cryo-EM structure of the actin filament hetero-decorated by Coronin-1 and Cofilin-1 on…

Browse structure collections

About this viewer

MolViewer shows 1T39 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.