Clostridium botulinum type E catalytic domain E212Q mutant. Determined by X-ray diffraction at 1.9 Å resolution. Released 29 Jun 2004.
Explore 1T3C in 3D Show helices and sheets RCSB PDB PDBe
1T3C contains 39 α-helices and 48 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-5 | 4 | |
| α-helix | 11-12 | 2 | |
| β-strand | 17-21 | 5 | 1 |
| β-strand | 29-35 | 7 | 1 |
| β-strand | 38-44 | 7 | 1 |
| α-helix | 51-54 | 4 | |
| β-strand | 68 | 1 | 2 |
| α-helix | 76-93 | 18 | |
| α-helix | 97-107 | 11 | |
| α-helix | 110-112 | 3 | |
| β-strand | 131-134 | 4 | 1 |
| β-strand | 140-143 | 4 | 1 |
| β-strand | 147-151 | 5 | 1 |
| β-strand | 155 | 1 | 2 |
| β-strand | 160-163 | 4 | 1 |
| α-helix | 167-169 | 3 | |
| α-helix | 172-174 | 3 | |
| β-strand | 181-184 | 4 | 1 |
| β-strand | 189-191 | 3 | 3 |
| β-strand | 192-194 | 3 | 4 |
| β-strand | 200-202 | 3 | 4 |
| α-helix | 203-204 | 2 | |
| α-helix | 205-220 | 16 | |
| β-strand | 231-232 | 2 | 5 |
| β-strand | 246-247 | 2 | 5 |
| α-helix | 248-254 | 7 | |
| α-helix | 256-261 | 6 | |
| α-helix | 264-286 | 23 | |
| α-helix | 293-295 | 3 | |
| α-helix | 296-305 | 10 | |
| β-strand | 308-310 | 3 | 6 |
| β-strand | 316-318 | 3 | 6 |
| α-helix | 320-332 | 13 | |
| α-helix | 335-342 | 8 | |
| β-strand | 356-359 | 4 | 3 |
| β-strand | 369 | 1 | 7 |
| β-strand | 373 | 1 | 7 |
| α-helix | 377-386 | 10 | |
| β-strand | 387 | 1 | 4 |
| α-helix | 392-394 | 3 | |
| β-strand | 395-396 | 2 | 3 |
| α-helix | 403-407 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-5 | 4 | |
| α-helix | 11-12 | 2 | |
| β-strand | 17-21 | 5 | 8 |
| α-helix | 28 | 1 | |
| β-strand | 29-35 | 7 | 8 |
| β-strand | 38-44 | 7 | 8 |
| α-helix | 51-54 | 4 | |
| β-strand | 62 | 1 | 9 |
| β-strand | 66 | 1 | 9 |
| β-strand | 68 | 1 | 10 |
| α-helix | 76-95 | 20 | |
| α-helix | 97-107 | 11 | |
| β-strand | 131-134 | 4 | 8 |
| β-strand | 140-143 | 4 | 8 |
| β-strand | 147-151 | 5 | 8 |
| β-strand | 155 | 1 | 10 |
| β-strand | 160-163 | 4 | 8 |
| β-strand | 166 | 1 | 11 |
| α-helix | 167-169 | 3 | |
| β-strand | 170 | 1 | 11 |
| α-helix | 172-174 | 3 | |
| β-strand | 181-184 | 4 | 8 |
| β-strand | 189-194 | 6 | 12 |
| β-strand | 200-202 | 3 | 12 |
| α-helix | 205-220 | 16 | |
| β-strand | 231 | 1 | 13 |
| β-strand | 247 | 1 | 13 |
| α-helix | 248-254 | 7 | |
| α-helix | 256-261 | 6 | |
| α-helix | 264-286 | 23 | |
| α-helix | 293-295 | 3 | |
| α-helix | 296-306 | 11 | |
| β-strand | 308-310 | 3 | 14 |
| β-strand | 316-318 | 3 | 14 |
| α-helix | 320-331 | 12 | |
| α-helix | 335-342 | 8 | |
| β-strand | 355-358 | 4 | 12 |
| β-strand | 359 | 1 | 15 |
| β-strand | 369 | 1 | 16 |
| β-strand | 373 | 1 | 16 |
| α-helix | 377-386 | 10 | |
| β-strand | 387 | 1 | 12 |
| α-helix | 392-394 | 3 | |
| β-strand | 395 | 1 | 15 |
| α-helix | 401-407 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| neurotoxin type E | A, B | protein | 421 | Clostridium botulinum | Q00496 (AlphaFold model) |
>1T3C_1 neurotoxin type E (chains A, B) PKINSFNYNDPVNDRTILYIKPGGCQEFYKSFNIMKNIWIIPERNVIGTTPQDFHPPTSL KNGDSSYYDPNYLQSDEEKDRFLKIVTKIFNRINNNLSGGILLEELSKANPYLGNDNTPD NQFHIGDASAVEIKFSNGSQDILLPNVIIMGAEPDLFETNSSNISLRNNYMPSNHGFGSI AIVTFSPEYSFRFNDNSMNEFIQDPALTLMHQLIHSLHGLYGAKGITTKYTITQKQNPLI TNIRGTNIEEFLTFGGTDLNIITSAQSNDIYTNLLADYKKIASKLSKVQVSNPLLNPYKD VFEAKYGLDKDASGIYSVNINKFNDIFKKLYSFTEFDLATKFQVKCRQTYIGQYKYFKLS NLLNDSIYNISEGYNINNLKVNFRGQNANLNPRIITPITGRGLVKKIIRFCKNIVSVKGI R
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
Water and common crystallization additives (CL) are not listed.
Structural analysis of botulinum neurotoxin type E catalytic domain and its mutant Glu212-->Gln reveals the pivotal role of the Glu212 carboxylate in the catalytic pathway. Agarwal, R., Eswaramoorthy, S., Kumaran, D. et al. Biochemistry (2004) 43:6637-6644. DOI 10.1021/bi036278w · PubMed
Other PDB entries of the same protein (UniProt Q00496 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1T3C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.