1T3L: PDB entry 1T3L

Structural Analysis of the Voltage-Dependent Calcium Channel Beta Subunit Functional Core in Complex with Alpha1 Interaction Domain. Determined by X-ray diffraction at 2.2 Å resolution. Released 25 May 2004.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Oryctolagus cuniculus
Chains: 2
Atoms: 2,671
Mol. weight: 40.53 kDa
Released: 25 May 2004

Explore 1T3L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1T3L contains 17 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	35-56	22
α-helix	60-61	2
β-strand	63-67	5	1
β-strand	71	1	2
β-strand	85	1	1
α-helix	86-87	2
β-strand	88	1	2
β-strand	93-99	7	1
β-strand	104-109	6	1
β-strand	117-120	4	1
α-helix	122-138	17
β-strand	221-224	4	1
α-helix	228-229	2
β-strand	230-233	4	3
α-helix	241-257	17
β-strand	262-267	6	3
α-helix	271-273	3
β-strand	275	1	4
α-helix	276-280	5
α-helix	286-289	4
α-helix	297-310	14
β-strand	316-321	6	3
α-helix	327-329	3
β-strand	333	1	4
β-strand	338-342	5	3
α-helix	347-355	9
α-helix	359-363	5
α-helix	365-377	13
α-helix	380-382	3
β-strand	385-387	3	3
α-helix	392-410	19

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	359-372	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dihydropyridine-sensitive L-type, calcium channel beta-2 subunit	A	protein	337	Oryctolagus cuniculus	P54288 (AlphaFold model)
Voltage-dependent L-type calcium channel alpha-1S subunit	B	protein	18		P07293 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1T3L_1 Dihydropyridine-sensitive L-type, calcium channel beta-2 subunit (chains A)
SRPSDSDVSLEEDREAVRREAERQAQAQLEKAKTKPVAFAVRTNVSYSAAHEDDVPVPGM
AISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSRVKLENMRLQHEQRAKEFKLHSK
EKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISIT
RVTADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQSEIERIFELARTLQLVVLDADTIN
HPAQLSKTSLAPIVVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPELFDV
ILDENQLEDACEHLADYLEAYWKATHPPSSNLPNPLL

Sequence of entity 2 (B), FASTA

>1T3L_2 Voltage-dependent L-type calcium channel alpha-1S subunit (chains B)
QQLEEDLRGYMSWITQGE

Primary citation

Structural Analysis of Voltage-Dependent Calcium Channel Beta Subunit Functional Core and Its Complex with the Alpha1 Interaction Domain. Opatowsky, Y., Chen, C.-C., Campbell, K.P. et al. Neuron (2004) 42:387-399. DOI 10.1016/S0896-6273(04)00250-8 · PubMed

Other PDB entries of the same protein (UniProt P54288 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4DEY 1.95 Å, Crystal structure of the Voltage Dependent Calcium Channel beta-2 Subunit in Complex…
4DEX 2.0 Å, Crystal structure of the Voltage Dependent Calcium Channel beta-2 Subunit in Complex…
1T3S 2.3 Å, Structural Analysis of the Voltage-Dependent Calcium Channel Beta Subunit Functional Core

Browse structure collections

About this viewer

MolViewer shows 1T3L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.