4DEX: Voltage Dependent Calcium Channel beta-2 Subunit

Crystal structure of the Voltage Dependent Calcium Channel beta-2 Subunit in Complex With The CaV2.2 I-II Linker. Determined by X-ray diffraction at 2.0 Å resolution. Released 13 Jun 2012.

Method: X-ray diffraction
Resolution: 2.0 Å
Organisms: Oryctolagus cuniculus, Rattus norvegicus
Chains: 2
Atoms: 2,826
Mol. weight: 51.54 kDa
Released: 13 Jun 2012

Explore 4DEX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4DEX contains 16 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	39-57	19
α-helix	60-61	2
β-strand	63-67	5	1
β-strand	71	1	2
β-strand	85	1	1
α-helix	86-87	2
β-strand	88	1	2
β-strand	93-99	7	1
β-strand	104-109	6	1
β-strand	117-120	4	1
α-helix	122-136	15
β-strand	221-224	4	1
α-helix	228-229	2
β-strand	230-233	4	3
α-helix	241-257	17
β-strand	262-267	6	3
α-helix	271-273	3
α-helix	276-279	4
α-helix	297-312	16
β-strand	316-321	6	3
α-helix	327-330	4
β-strand	338-342	5	3
α-helix	347-356	10
α-helix	359-363	5
α-helix	365-376	12
α-helix	380-382	3
β-strand	385-387	3	3
α-helix	392-410	19

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	364-403	40

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Voltage-dependent L-type calcium channel subunit beta-2	A	protein	339	Oryctolagus cuniculus	P54288 (AlphaFold model)
Voltage-dependent N-type calcium channel subunit alpha-1B	B	protein	113	Rattus norvegicus	Q02294 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4DEX_1 Voltage-dependent L-type calcium channel subunit beta-2 (chains A)
GSSRPSDSDVSLEEDREAVRREAERQAQAQLEKAKTKPVAFAVRTNVSYSAAHEDDVPVP
GMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQRAKEFKLH
SKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRIS
ITRVTADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQSEIERIFELARTLQLVVLDADT
INHPAQLSKTSLAPIVVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPELF
DVILDENQLEDACEHLADYLEAYWKATHPPSSNLPNPLL

Sequence of entity 2 (B), FASTA

>4DEX_2 Voltage-dependent N-type calcium channel subunit alpha-1B (chains B)
GSEFAKERERVENRRAFLKLRRQQQIERELNGYLEWIFKAEEVMLAEEDKNAEEKSPLDA
VLKRAATKKSRNDLIHAEEGEDRFVDLCAAGSPFARASLKSGKTESSSYFRRK

Primary citation

The role of a voltage-dependent Ca2+ channel intracellular linker: a structure-function analysis. Almagor, L., Chomsky-Hecht, O., Ben-Mocha, A. et al. J Neurosci (2012) 32:7602-7613. DOI 10.1523/JNEUROSCI.5727-11.2012 · PubMed

Other PDB entries of the same protein (UniProt P54288 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4DEY 1.95 Å, Crystal structure of the Voltage Dependent Calcium Channel beta-2 Subunit in Complex…
1T3L 2.2 Å, Structural Analysis of the Voltage-Dependent Calcium Channel Beta Subunit Functional…
1T3S 2.3 Å, Structural Analysis of the Voltage-Dependent Calcium Channel Beta Subunit Functional Core

Browse structure collections

About this viewer

MolViewer shows 4DEX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.