1T5I: C-terminal domain of UAP56

Crystal structure of the C-terminal domain of UAP56. Determined by X-ray diffraction at 1.9 Å resolution. Released 31 Aug 2004.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,398
Mol. weight: 20.04 kDa
Released: 31 Aug 2004

Explore 1T5I in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1T5I contains 8 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	263-268	6	1
α-helix	271-273	3
α-helix	274-284	11
β-strand	290-293	4	1
α-helix	297-309	13
β-strand	314-317	4	1
α-helix	323-334	12
β-strand	340-343	4	1
α-helix	353-355	3
β-strand	358-361	4	1
α-helix	368-378	11
α-helix	380-382	3
β-strand	386-391	6	1
α-helix	394-407	14
β-strand	411-413	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
C_terminal domain of a probable ATP-dependent RNA helicase	A	protein	172	Homo sapiens	Q13838 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1T5I_1 C_TERMINAL DOMAIN OF A PROBABLE ATP-DEPENDENT RNA HELICASE (chains A)
GSLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIA
IHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVA
RAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR

Primary citation

Crystal structure of UAP56, a "DEXD/H-box" protein involved in pre-mRNA splicing and mRNA export. Zhao, R., Shen, J., Green, M.R. et al. Structure (2004) 12:1373-1381. DOI 10.1016/j.str.2004.06.006 · PubMed

Other PDB entries of the same protein (UniProt Q13838 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1T6N 1.94 Å, Crystal structure of the N-terminal domain of human UAP56
1XTI 1.95 Å, Structure of Wildtype human UAP56
1XTK 2.4 Å, structure of DECD to DEAD mutation of human UAP56
8ENK 2.5 Å, Crystal structure of UAP56 in complex with Tho1, the yeast homolog of human SARNP
9RV1 2.62 Å, Cryo-EM structure of the human UAP56-RNA - SAC3D1-PCID2-SEM1 complex
1XTJ 2.7 Å, structure of human UAP56 in complex with ADP
9DLP 2.79 Å, Cryo-EM structure of human TREX-2 complex bound to DDX39B(UAP56)
9T6L 2.9 Å, Cryo-EM structure of the human LENG8-PCID2-DSS1 complex bound to UAP56 and RRP1B
9DLV 2.97 Å, Cryo-EM structure of the human TREX-2.1 complex (LENG8/PCID2/DSS1) bound to DDX39B(UAP56)
9T6N 3.0 Å, Cryo-EM structure of the human GANP-PCID2-DSS1 complex bound to UAP56
9DLR 3.08 Å, Cryo-EM structure of the human TREX-2.1 complex (LENG8/PCID2/DSS1) bound to the…
7APK 3.3 Å, Structure of the human THO - UAP56 complex

Browse structure collections

About this viewer

MolViewer shows 1T5I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.