1XTI: Wildtype human UAP56

Structure of Wildtype human UAP56. Determined by X-ray diffraction at 1.95 Å resolution. Released 14 Dec 2004.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,348
Mol. weight: 45.31 kDa
Ligands: IPA
Released: 14 Dec 2004

Explore 1XTI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1XTI contains 19 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	47-50	4
α-helix	54-63	10
α-helix	70-79	10
β-strand	85-88	4	1
α-helix	95-106	12
β-strand	116-119	4	1
α-helix	123-136	14
β-strand	145-148	4	1
α-helix	154-163	10
β-strand	168-171	4	1
α-helix	173-181	9
β-strand	192-195	4	1
α-helix	198-201	4
α-helix	205-216	12
β-strand	223-228	6	1
α-helix	235-242	8
α-helix	246	1
β-strand	247-250	4	1
β-strand	263-268	6	2
α-helix	271-273	3
α-helix	274-284	11
β-strand	289-293	5	2
α-helix	297-309	13
β-strand	314-317	4	2
α-helix	323-334	12
β-strand	340-343	4	2
β-strand	351	1	3
β-strand	356-361	6	2
α-helix	368-375	8
β-strand	377	1	3
β-strand	386-391	6	2
α-helix	394-406	13
β-strand	412-413	2	2
α-helix	414-415	2
α-helix	420-422	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Probable ATP-dependent RNA helicase p47	A	protein	391	Homo sapiens	Q13838 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1XTI_1 Probable ATP-dependent RNA helicase p47 (chains A)
GSPGHMSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTA
VFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKD
EEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRM
TPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRK
LFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQ
RRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDA
KILNDVQDRFEVNISELPDEIDISSYIEQTR

Ligands and cofactors

ID	Name	Formula	Copies
IPA	Isopropyl alcohol	C3 H8 O	4

Primary citation

Crystal structure of the human ATP-dependent splicing and export factor UAP56. Shi, H., Cordin, O., Minder, C.M. et al. Proc Natl Acad Sci U S A (2004) 101:17628-17633. DOI 10.1073/pnas.0408172101 · PubMed

Other PDB entries of the same protein (UniProt Q13838 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1T5I 1.9 Å, Crystal structure of the C-terminal domain of UAP56
1T6N 1.94 Å, Crystal structure of the N-terminal domain of human UAP56
1XTK 2.4 Å, structure of DECD to DEAD mutation of human UAP56
8ENK 2.5 Å, Crystal structure of UAP56 in complex with Tho1, the yeast homolog of human SARNP
9RV1 2.62 Å, Cryo-EM structure of the human UAP56-RNA - SAC3D1-PCID2-SEM1 complex
1XTJ 2.7 Å, structure of human UAP56 in complex with ADP
9DLP 2.79 Å, Cryo-EM structure of human TREX-2 complex bound to DDX39B(UAP56)
9T6L 2.9 Å, Cryo-EM structure of the human LENG8-PCID2-DSS1 complex bound to UAP56 and RRP1B
9DLV 2.97 Å, Cryo-EM structure of the human TREX-2.1 complex (LENG8/PCID2/DSS1) bound to DDX39B(UAP56)
9T6N 3.0 Å, Cryo-EM structure of the human GANP-PCID2-DSS1 complex bound to UAP56
9DLR 3.08 Å, Cryo-EM structure of the human TREX-2.1 complex (LENG8/PCID2/DSS1) bound to the…
7APK 3.3 Å, Structure of the human THO - UAP56 complex

Browse structure collections

About this viewer

MolViewer shows 1XTI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.