1T5Z: Androgen receptor

Crystal Structure of the Androgen Receptor Ligand Binding Domain (LBD) with DHT and a peptide derived from its physiological coactivator ARA70. Determined by X-ray diffraction at 2.3 Å resolution. Released 25 Jan 2005.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,249
Mol. weight: 31.46 kDa
Ligands: DHT
Released: 25 Jan 2005

Explore 1T5Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1T5Z contains 16 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	672-680	9
α-helix	694-695	2
α-helix	697-720	24
α-helix	725-727	3
α-helix	730-757	28
β-strand	762-765	4	1
β-strand	768-770	3	1
α-helix	772-777	6
α-helix	781-796	16
α-helix	801-810	10
α-helix	811-813	3
β-strand	815-817	3	2
α-helix	824-843	20
α-helix	849-864	16
α-helix	866-882	17
α-helix	884-887	4
α-helix	893-901	9
α-helix	903-907	5
β-strand	911-913	3	2

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	922-928	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Androgen receptor	A	protein	251	Homo sapiens	P10275 (AlphaFold model)
Nuclear receptor coactivator 4	B	protein	15	Homo sapiens	Q13772 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1T5Z_1 Androgen receptor (chains A)
CQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNL
HVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMR
HLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKN
PTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILS
GKVKPIYFHTQ

Sequence of entity 2 (B), FASTA

>1T5Z_2 Nuclear receptor coactivator 4 (chains B)
RETSEKFKLLFQSYN

Ligands and cofactors

ID	Name	Formula	Copies
DHT	5-alpha-dihydrotestosterone	C19 H30 O2	1

Primary citation

The Molecular Mechanisms of Coactivator Utilization in Ligand-dependent Transactivation by the Androgen Receptor. Estebanez-Perpina, E., Moore, J.M.R., Mar, E. et al. J Biol Chem (2005) 280:8060-8068. DOI 10.1074/jbc.M407046200 · PubMed

Other PDB entries of the same protein (UniProt P10275 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8E1A 1.2 Å, Structure-based study to overcome cross-reactivity of novel androgen receptor inhibitors
7ZTZ 1.4 Å, Crystal structure of mutant AR-LBD (Y764C) bound to dihydrotestosterone
4OHA 1.42 Å, Crystal structure of T877A-AR-LBD bound with co-regulator peptide
5V8Q 1.44 Å, Synthesis and biological evaluation of novel selective androgen receptor modulators…
2AX6 1.5 Å, Crystal Structure Of The Androgen Receptor Ligand Binding Domain T877A Mutant In Complex…
3L3X 1.55 Å, Crystal structure of DHT-bound androgen receptor in complex with the first motif of…
8FH0 1.59 Å, Crystal structure of mutant Androgen Receptor ligand binding domain H875Y/F877L/T878A…
8FH2 1.59 Å, Crystal structure of mutant Androgen Receptor ligand binding domain L702H/H875Y with DHT
8FGZ 1.61 Å, Crystal structure of mutant Androgen Receptor ligand binding domain L702H/H875Y/F877L…
2AM9 1.64 Å, Crystal structure of human androgen receptor ligand binding domain in complex with…
2AX9 1.65 Å, Crystal Structure Of The Androgen Receptor Ligand Binding Domain In Complex With R-3
2PNU 1.65 Å, Crystal structure of human androgen receptor ligand-binding domain in complex with EM-5744

Browse structure collections

About this viewer

MolViewer shows 1T5Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.