1T7P: DNA-directed DNA polymerase

T7 DNA polymerase complexed to DNA primer/template,a nucleoside triphosphate, and its processivity factor thioredoxin. Determined by X-ray diffraction at 2.2 Å resolution. Released 25 Feb 1998.

Method: X-ray diffraction
Resolution: 2.2 Å
Organisms: Enterobacteria phage T7, Escherichia coli O157:H7
Chains: 4
Atoms: 7,092
Mol. weight: 98.61 kDa
Ligands: DG3, MG
Released: 25 Feb 1998

Explore 1T7P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1T7P contains 42 α-helices and 42 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 38 helices, 34 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	1
α-helix	12-14	3
β-strand	18-25	8	1
β-strand	30-34	5	1
α-helix	36-38	3
α-helix	39-51	13
β-strand	56-58	3	1
α-helix	61-65	5
α-helix	66-72	7
α-helix	73-77	5
α-helix	85-87	3
β-strand	88-90	3	1
α-helix	91-98	8
α-helix	127-149	23
α-helix	152-154	3
α-helix	158-160	3
α-helix	165-186	22
α-helix	203-209	7
α-helix	212-230	19
β-strand	232-233	2	2
β-strand	234	1	3
α-helix	236-260	25
β-strand	264-267	4	4
β-strand	272	1	5
α-helix	273-274	2
β-strand	275	1	6
β-strand	282	1	6
α-helix	287-288	2
β-strand	289	1	5
β-strand	290	1	7
β-strand	326	1	7
β-strand	327-328	2	8
β-strand	329-332	4	4
α-helix	340-347	8
β-strand	356-357	2	9
β-strand	361-362	2	9
α-helix	366-371	6
α-helix	377-396	20
α-helix	397-401	5
α-helix	406-409	4
β-strand	410	1	2
β-strand	415-416	2	2
β-strand	419-421	3	10
β-strand	431-433	3	10
α-helix	440-442	3
α-helix	448-453	6
β-strand	455	1	3
α-helix	457-459	3
β-strand	461	1	11
α-helix	467	1
β-strand	468	1	11
α-helix	469	1
β-strand	470-476	7	12
α-helix	479-487	9
α-helix	489-492	4
α-helix	495-499	5
α-helix	505-513	9
α-helix	518-529	12
α-helix	534-541	8
α-helix	545-558	14
α-helix	561-573	13
β-strand	574	1	13
β-strand	588	1	13
β-strand	592-594	3	14
β-strand	600-602	3	14
α-helix	606-608	3
α-helix	609-634	26
β-strand	640	1	12
β-strand	646-651	6	12
β-strand	655-660	6	12
α-helix	663-683	21
β-strand	692-697	6	12

Chain B: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	5-6	2	15
α-helix	9-15	7
β-strand	22-28	7	15
α-helix	33-48	16
β-strand	50	1	16
β-strand	53	1	16
β-strand	54-59	6	15
α-helix	67-70	4
β-strand	74-75	2	8
β-strand	77-82	6	15
β-strand	85-91	7	15
α-helix	96-106	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-D(PGPCPCPAPGPTPGPCPCPAP*2DA)-3')	P	DNA	11
DNA (5'-d(pcpcptptpgpgpcpapcptpgpgp*c)-3')	T	DNA	13
DNA-directed DNA polymerase	A	protein	698	Enterobacteria phage T7	P00581
Thioredoxin 1	B	protein	108	Escherichia coli O157:H7	P0AA25 (AlphaFold model)

Sequence of entity 1 (P), FASTA

>1T7P_1 DNA (5'-D(P*GP*CP*CP*AP*GP*TP*GP*CP*CP*AP*2DA)-3') (chains P)
GCCAGTGCCAA

Sequence of entity 2 (T), FASTA

>1T7P_2 DNA (5'-D(P*CP*CP*TP*TP*GP*GP*CP*AP*CP*TP*GP*GP*C)-3') (chains T)
CCTTGGCACTGGC

Sequence of entity 3 (A), FASTA

>1T7P_3 DNA-directed DNA polymerase (chains A)
MIVSDIEANALLESVTKFHCGVIYDYSTAEYVSYRPSDFGAYLDALEAEVARGGLIVFHN
GHKYDVPALTKLAKLQLNREFHLPRENCIDTLVLSRLIHSNLKDTDMGLLRSGKLPGALE
AWGYRLGEMKGEYKDDFKRMLEEQGEEYVDGMEWWNFNEEMMDYNVQDVVVTKALLEKLL
SDKHYFPPEIDFTDVGYTTFWSESLEAVDIEHRAAWLLAKQERNGFPFDTKAIEELYVEL
AARRSELLRKLTETFGSWYQPKGGTEMFCHPRTGKPLPKYPRIKTPKVGGIFKKPKNKAQ
REGREPCELDTREYVAGAPYTPVEHVVFNPSSRDHIQKKLQEAGWVPTKYTDKGAPVVDD
EVLEGVRVDDPEKQAAIDLIKEYLMIQKRIGQSAEGDKAWLRYVAEDGKIHGSVNPNGAV
TGRATHAFPNLAQIPGVRSPYGEQCRAAFGAEHHLDGITGKPWVQAGIDASGLELRCLAH
FMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAGDEKIGQIVGAGKE
RGKELKKKFLENTPAIAALRESIQQTLVESSQWVAGEQQVKWKRRWIKGLDGRKVHVRSP
HAALNTLLQSAGALICKLWIIKTEEMLVEKGLKHGWDGDFAYMAWVHDEIQVGCRTEEIA
QVVIETAQEAMRWVGDHWNFRCLLDTEGKMGPNWAICH

Sequence of entity 4 (B), FASTA

>1T7P_4 Thioredoxin 1 (chains B)
SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNI
DQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA

Ligands and cofactors

ID	Name	Formula	Copies
DG3	2'-3'-dideoxyguanosine-5'-triphosphate	C10 H16 N5 O12 P3	1
MG	Magnesium ion	Mg	3

Primary citation

Crystal structure of a bacteriophage T7 DNA replication complex at 2.2 A resolution. Doublie, S., Tabor, S., Long, A.M. et al. Nature (1998) 391:251-258. DOI 10.1038/34593 · PubMed

Other PDB entries of the same protein (UniProt P00581), best resolution first:

1X9M 2.1 Å, T7 DNA polymerase in complex with an N-2-acetylaminofluorene-adducted DNA
1SL1 2.2 Å, Binary 5' complex of T7 DNA polymerase with a DNA primer/template containing a cis-syn…
1TK5 2.2 Å, T7 DNA polymerase binary complex with 8 oxo guanosine in the templating strand
1SKS 2.3 Å, Binary 3' complex of T7 DNA polymerase with a DNA primer/template containing a cis-syn…
1SKW 2.3 Å, Binary 3' complex of T7 DNA polymerase with a DNA primer/template containing a…
1SL2 2.3 Å, Ternary 5' complex of T7 DNA polymerase with a DNA primer/template containing a cis-syn…
1TK0 2.3 Å, T7 DNA polymerase ternary complex with 8 oxo guanosine and ddCTP at the insertion site
1X9W 2.3 Å, T7 DNA polymerase in complex with a primer/template DNA containing a disordered N-2…
1SKR 2.4 Å, T7 DNA Polymerase Complexed To DNA Primer/Template and ddATP
1TKD 2.49 Å, T7 DNA polymerase ternary complex with 8 oxo guanosine and dCMP at the elongation site
1TK8 2.5 Å, T7 DNA polymerase ternary complex with 8 oxo guanosine and dAMP at the elongation site
1T8E 2.54 Å, T7 DNA Polymerase Ternary Complex with dCTP at the Insertion Site.

Browse more

1T7P is part of these collections:

DNA and RNA

About this viewer

MolViewer shows 1T7P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.