1TEF: Plastocyanin, chloroplast

Crystal structure of the spinach plastocyanin mutants G8D/K30C/T69C and K30C/T69C- a study of the effect on crystal packing and thermostability from the introduction of a novel disulfide bond. Determined by X-ray diffraction at 1.9 Å resolution. Released 1 Nov 2005.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Spinacia oleracea
Chains: 2
Atoms: 1,668
Mol. weight: 21.07 kDa
Ligands: CU
Released: 1 Nov 2005

Explore 1TEF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1TEF contains 6 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	1
β-strand	14-15	2	1
β-strand	18-21	4	2
β-strand	26-31	6	1
β-strand	37	1	3
β-strand	40-41	2	2
α-helix	52-55	4
α-helix	57-58	2
β-strand	63	1	3
β-strand	69-73	5	1
β-strand	78-83	6	2
α-helix	88-90	3
β-strand	93-98	6	2

Chain B: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	4
β-strand	14-15	2	4
β-strand	18-21	4	5
β-strand	26-31	6	4
β-strand	37	1	6
β-strand	40-41	2	5
α-helix	52-55	4
α-helix	57-58	2
β-strand	63	1	6
β-strand	69-73	5	4
β-strand	78-83	6	5
α-helix	85-90	6
β-strand	93-98	6	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Plastocyanin, chloroplast	A, B	protein	99	Spinacia oleracea	P00289 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1TEF_1 Plastocyanin, chloroplast (chains A, B)
VEVLLGGDDGSLAFLPGDFSVASGEEIVFCNNAGFPHNVVFDEDEIPSGVDAAKISMSEE
DLLNAPGECYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN

Ligands and cofactors

ID	Name	Formula	Copies
CU	Copper (II) ion	Cu	2

Water and common crystallization additives (CL) are not listed.

Primary citation

Novel Disulfide Bonds Effect the Thermostability of Plastocyanin. Crystal structures of the triple plastocyanin mutant G8D/K30C/T69C and the double plastocyanin mutant K30C/T69C from spinach at 1.90 and 1.96 resolution, respectively. Okvist, M., Jacobson, F., Jansson, H. et al. To be published.

Other PDB entries of the same protein (UniProt P00289 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1AG6 1.6 Å, Plastocyanin from spinach
1TEG 1.96 Å, Crystal structure of the spinach plastocyanin mutants G8D/K30C/T69C and K30C/T69C- a…
1OOW 2.0 Å, The crystal structure of the spinach plastocyanin double mutant G8D/L12E gives insight…
9TGG 3.18 Å, Cryo-EM structure of Spinacia oleracea cytochrome b6f complex with bound plastocyanin
1YLB NMR solution structure of the reduced spinach plastocyanin
2PCF The complex of cytochrome F and plastocyanin determined with paramagnetic NMR. Based on…

Browse structure collections

About this viewer

MolViewer shows 1TEF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.