1TEG: Plastocyanin, chloroplast

Crystal structure of the spinach plastocyanin mutants G8D/K30C/T69C and K30C/T69C- a study of the effect on crystal packing and thermostability from the introduction of a novel disulfide bond. Determined by X-ray diffraction at 1.96 Å resolution. Released 1 Nov 2005.

Method: X-ray diffraction
Resolution: 1.96 Å
Organism: Spinacia oleracea
Chains: 2
Atoms: 1,547
Mol. weight: 20.96 kDa
Ligands: CU
Released: 1 Nov 2005

Explore 1TEG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1TEG contains 5 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	1
β-strand	14-15	2	1
β-strand	18-21	4	2
β-strand	26-31	6	1
β-strand	37	1	3
β-strand	40-41	2	2
α-helix	43-45	3
α-helix	52-55	4
β-strand	63	1	3
β-strand	69-73	5	1
β-strand	78-83	6	2
α-helix	85-90	6
β-strand	93-98	6	2

Chain B: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	4
β-strand	14-15	2	4
β-strand	18-21	4	5
β-strand	26-31	6	4
β-strand	37	1	6
β-strand	40-41	2	5
α-helix	52-55	4
β-strand	63	1	6
β-strand	69-73	5	4
β-strand	78-83	6	5
α-helix	85-90	6
β-strand	93-98	6	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Plastocyanin, chloroplast	A, B	protein	99	Spinacia oleracea	P00289 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1TEG_1 Plastocyanin, chloroplast (chains A, B)
VEVLLGGGDGSLAFLPGDFSVASGEEIVFCNNAGFPHNVVFDEDEIPSGVDAAKISMSEE
DLLNAPGECYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN

Ligands and cofactors

ID	Name	Formula	Copies
CU	Copper (II) ion	Cu	2

Water and common crystallization additives (CL) are not listed.

Primary citation

Novel Disulfide Bonds Effect the Thermostability of Plastocyanin. Crystal structures of the triple plastocyanin mutant G8D/K30C/T69C and the double plastocyanin mutant K30C/T69C from spinach at 1.90 A and 1.96 A resolution, respectively. Okvist, M., Jacobson, F., Jansson, H. et al. To be published.

Other PDB entries of the same protein (UniProt P00289 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1AG6 1.6 Å, Plastocyanin from spinach
1TEF 1.9 Å, Crystal structure of the spinach plastocyanin mutants G8D/K30C/T69C and K30C/T69C- a…
1OOW 2.0 Å, The crystal structure of the spinach plastocyanin double mutant G8D/L12E gives insight…
9TGG 3.18 Å, Cryo-EM structure of Spinacia oleracea cytochrome b6f complex with bound plastocyanin
1YLB NMR solution structure of the reduced spinach plastocyanin
2PCF The complex of cytochrome F and plastocyanin determined with paramagnetic NMR. Based on…

Browse structure collections

About this viewer

MolViewer shows 1TEG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.