1TGH: Tata binding protein (tbp)/dna complex

Tata binding protein (tbp)/dna complex. Determined by X-ray diffraction at 2.9 Å resolution. Released 1 Aug 1996.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 3
Atoms: 1,933
Mol. weight: 28.12 kDa
Released: 1 Aug 1996

Explore 1TGH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1TGH contains 4 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	160-169	10	1
α-helix	176-182	7
β-strand	186-188	3	1
β-strand	195-198	4	1
β-strand	201	1	2
β-strand	204	1	2
β-strand	206-210	5	1
β-strand	214-218	5	1
α-helix	223-238	16
β-strand	247-259	13	1
β-strand	264	1	3
α-helix	266-272	7
β-strand	286-290	5	1
β-strand	297-301	5	1
β-strand	305-309	5	1
α-helix	314-329	16
β-strand	332	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-d(cpgptpaptpaptpaptpapcpg)-3')	B, C	DNA	12
Protein (tata binding protein (tbp))	A	protein	185	Homo sapiens	P20226 (AlphaFold model)

Sequence of entity 1 (B, C), FASTA

>1TGH_1 DNA (5'-D(*CP*GP*TP*AP*TP*AP*TP*AP*TP*AP*CP*G)-3') (chains B, C)
CGTATATATACG

Sequence of entity 2 (A), FASTA

>1TGH_2 PROTEIN (TATA BINDING PROTEIN (TBP)) (chains A)
GSRGSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIF
SSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLV
LTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKG
FRKTT

Primary citation

How proteins recognize the TATA box. Juo, Z.S., Chiu, T.K., Leiberman, P.M. et al. J Mol Biol (1996) 261:239-254. DOI 10.1006/jmbi.1996.0456 · PubMed

Other PDB entries of the same protein (UniProt P20226 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1CDW 1.9 Å, Human tbp core domain complexed with DNA
4ROC 1.9 Å, Human TFIIB-related factor 2 (Brf2) and TBP bound to U6#2 promoter
1NVP 2.1 Å, Human tfiia/tbp/dna complex
4ROE 2.2 Å, Human TFIIB-related factor 2 (Brf2) and TBP bound to RPPH1 promoter
7NVU 2.5 Å, RNA polymerase II core pre-initiation complex with open promoter DNA
1JFI 2.62 Å, Crystal Structure of the NC2-TBP-DNA Ternary Complex
1C9B 2.65 Å, Crystal structure of a human tbp core domain-human tfiib core domain complex bound to an…
4ROD 2.7 Å, Human TFIIB-related factor 2 (Brf2) and TBP bound to TRNAU1 promoter
5N9G 2.7 Å, TFIIIB -TBP/Brf2/DNA and SANT domain of Bdp1-
7NVS 2.8 Å, RNA polymerase II core pre-initiation complex with closed promoter DNA in proximal…
7NVT 2.9 Å, RNA polymerase II core pre-initiation complex with closed promoter DNA in distal position
8S52 2.9 Å, RNA polymerase II core initially transcribing complex with an ordered RNA of 10 nt

Browse structure collections

About this viewer

MolViewer shows 1TGH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.