1TGZ: Human Senp2

Structure of human Senp2 in complex with SUMO-1. Determined by X-ray diffraction at 2.8 Å resolution. Released 14 Sept 2004.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,608
Mol. weight: 36.55 kDa
Released: 14 Sept 2004

Explore 1TGZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1TGZ contains 16 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	370-380	11
β-strand	388-392	5	1
β-strand	395-398	4	1
α-helix	399-403	5
α-helix	409-410	2
β-strand	411-412	2	2
α-helix	413-430	18
β-strand	435-437	3	3
α-helix	442-454	13
α-helix	455-458	4
α-helix	463-465	3
β-strand	468-475	8	3
β-strand	478-485	8	3
α-helix	486-488	3
β-strand	490-494	5	3
α-helix	502-519	18
α-helix	526-528	3
β-strand	530-533	4	3
α-helix	548-559	12
α-helix	569-571	3
α-helix	572-584	13

Chain B: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	22-28	7	4
β-strand	35-38	4	4
α-helix	45-53	9
α-helix	59-61	3
β-strand	62-66	5	4
β-strand	69-70	2	4
α-helix	77-80	4
β-strand	87-92	6	4
β-strand	95-96	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sentrin-specific protease 2	A	protein	226	Homo sapiens	Q9HC62 (AlphaFold model)
Ubiquitin-like protein SMT3C	B	protein	80	Homo sapiens	P63165 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1TGZ_1 Sentrin-specific protease 2 (chains A)
DLLELTEDMEKEISNALGHGPQDEILSSAFKLRITRGDIQTLKNYHWLNDEVINFYMNLL
VERNKKQGYPALHVFSTFFYPKLKSGGYQAVKRWTKGVNLFEQEIILVPIHRKVHWSLVV
IDLRKKCLKYLDSMGQKGHRICEILLQYLQDESKTKRNSDLNLLEWTHHSMKPHEIPQQL
NGSDCGMFTCKYADYISRDKPITFTQHQMPLFRKKMVWEILHQQLL

Sequence of entity 2 (B), FASTA

>1TGZ_2 Ubiquitin-like protein SMT3C (chains B)
EGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTP
KELGMEEEDVIEVYQEQTGG

Primary citation

A basis for SUMO protease specificity provided by analysis of human Senp2 and a Senp2-SUMO complex. Reverter, D., Lima, C.D. Structure (2004) 12:1519-1531. DOI 10.1016/j.str.2004.05.023 · PubMed

Other PDB entries of the same protein (UniProt Q9HC62 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3ZO5 2.15 Å, Structure of SENP2-Loop1 in complex with preSUMO-2
1TH0 2.2 Å, Structure of human Senp2
2IO0 2.3 Å, Crystal structure of human Senp2 in complex with preSUMO-2
2IO1 2.6 Å, Crystal structure of human Senp2 in complex with preSUMO-3
2IO2 2.9 Å, Crystal structure of human Senp2 in complex with RanGAP1-SUMO-1
5AEK 3.0 Å, Crystal structure of the human SENP2 C548S in complex with the human SUMO1 K48M F66W
2IO3 3.2 Å, Crystal structure of human Senp2 in complex with RanGAP1-SUMO-2

Browse structure collections

About this viewer

MolViewer shows 1TGZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.