3ZO5: SENP2-Loop1

Structure of SENP2-Loop1 in complex with preSUMO-2. Determined by X-ray diffraction at 2.15 Å resolution. Released 29 Jan 2014.

Method: X-ray diffraction
Resolution: 2.15 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 2,595
Mol. weight: 38.12 kDa
Released: 29 Jan 2014

Explore 3ZO5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3ZO5 contains 16 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	367-369	3
α-helix	370-380	11
β-strand	388-392	5	1
α-helix	394	1
β-strand	401-404	4	1
α-helix	405-408	4
α-helix	409-411	3
α-helix	415-417	3
α-helix	419-436	18
β-strand	441-443	3	2
α-helix	448-460	13
α-helix	461-464	4
α-helix	469-471	3
β-strand	474-480	7	2
β-strand	485-491	7	2
β-strand	496-501	6	2
α-helix	508-526	19
β-strand	536-539	4	2
α-helix	554-566	13
α-helix	575-577	3
α-helix	578-591	14

Chain B: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	17-23	7	3
β-strand	29-35	7	3
α-helix	40-51	12
α-helix	55-57	3
β-strand	58-62	5	3
β-strand	65-66	2	3
β-strand	82-88	7	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sentrin-specific protease 2	A	protein	238	HOMO SAPIENS	Q9HC62 (AlphaFold model)
Small ubiquitin-related modifier 2	B	protein	89	HOMO SAPIENS	P61956 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3ZO5_1 SENTRIN-SPECIFIC PROTEASE 2 (chains A)
GSHMADDLLELTEDMEKEISNALGHGPQDEILSSAPPPPAKGGLRITRGDIQTLKNYHWL
NDEVINFYMNLLVERNKKQGYPALHVFSTFFYPKLKSGGYQAVKRWTKGVNLFEQEIILV
PIHRKVHWSLVVIDLRKKCLKYLDSMGQKGHRICEILLQYLQDESKTKRNSDLNLLEWTH
HSMKPHEIPQQLNGSDSGMFTCKYADYISRDKPITFTQHQMPLFRKKMVWEILHQQLL

Sequence of entity 2 (B), FASTA

>3ZO5_2 SMALL UBIQUITIN-RELATED MODIFIER 2 (chains B)
MANDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDT
PAQLEMEDEDTIDVFQQQTGGVYLEHHHH

Primary citation

Structural Insights Into the Senp6 Loop1 Structure in Complex with Sumo2. Alegre, K.O., Reverter, D. Protein Sci (2014) 23:433. DOI 10.1002/PRO.2425 · PubMed

Other PDB entries of the same protein (UniProt Q9HC62 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1TH0 2.2 Å, Structure of human Senp2
2IO0 2.3 Å, Crystal structure of human Senp2 in complex with preSUMO-2
2IO1 2.6 Å, Crystal structure of human Senp2 in complex with preSUMO-3
1TGZ 2.8 Å, Structure of human Senp2 in complex with SUMO-1
2IO2 2.9 Å, Crystal structure of human Senp2 in complex with RanGAP1-SUMO-1
5AEK 3.0 Å, Crystal structure of the human SENP2 C548S in complex with the human SUMO1 K48M F66W
2IO3 3.2 Å, Crystal structure of human Senp2 in complex with RanGAP1-SUMO-2

Browse structure collections

About this viewer

MolViewer shows 3ZO5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.