Offset of a catalytic lesion by a bound water soluble. Determined by X-ray diffraction at 1.9 Å resolution. Released 14 Feb 1995.
Explore 1TPC in 3D Show helices and sheets RCSB PDB PDBe
1TPC contains 32 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 6-11 | 6 | 1 |
| β-strand | 14 | 1 | 2 |
| α-helix | 18-30 | 13 | |
| β-strand | 37-43 | 7 | 1 |
| α-helix | 45-47 | 3 | |
| α-helix | 48-54 | 7 | |
| β-strand | 60-63 | 4 | 1 |
| β-strand | 72 | 1 | 3 |
| α-helix | 80-85 | 6 | |
| β-strand | 90-93 | 4 | 1 |
| α-helix | 96-100 | 5 | |
| α-helix | 106-118 | 13 | |
| β-strand | 122-127 | 6 | 1 |
| α-helix | 131-135 | 5 | |
| α-helix | 139-151 | 13 | |
| α-helix | 157-159 | 3 | |
| β-strand | 160-164 | 5 | 1 |
| α-helix | 167-169 | 3 | |
| α-helix | 175-177 | 3 | |
| α-helix | 178-195 | 18 | |
| α-helix | 198-203 | 6 | |
| β-strand | 206-209 | 4 | 1 |
| α-helix | 217-221 | 5 | |
| β-strand | 228-231 | 4 | 1 |
| α-helix | 233-236 | 4 | |
| α-helix | 240-244 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Triosephosphate isomerase | 1, 2 | protein | 247 | Gallus gallus | P00940 (AlphaFold model) |
>1TPC_1 TRIOSEPHOSPHATE ISOMERASE (chains 1, 2) APRKFFVGGNWKMNGDKKSLGELIHTLNGAKLSADTEVVCGAPSIYLDFARQKLDAKIGV AAQNCYKVPKGAFTGEISPAMIKDIGAAWVILGHPERRHVFGESDELIGQKVAHALAEGL GVIACIGEKLDEREAGITEKVVFEQTKAIADNVKDWSKVVLAYDPVWAIGTGKTATPQQA QEVHEKLRGWLKTHVSDAVAQSTRIIYGGSVTGGNCKELASQHDVDGFLVGGASLKPEFV DIINAKH
| ID | Name | Formula | Copies |
|---|---|---|---|
| PGH | Phosphoglycolohydroxamic acid | C2 H6 N O6 P | 2 |
The structural basis for pseudoreversion of the E165D lesion by the secondary S96P mutation in triosephosphate isomerase depends on the positions of active site water molecules. Komives, E.A., Lougheed, J.C., Liu, K. et al. Biochemistry (1995) 34:13612-13621. DOI 10.1021/bi00041a041 · PubMed
Other PDB entries of the same protein (UniProt P00940 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1TPC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.