1U3H: Mouse TCR 172.10

Crystal structure of mouse TCR 172.10 complexed with MHC class II I-Au molecule at 2.4 A. Determined by X-ray diffraction at 2.42 Å resolution. Released 17 May 2005.

Method: X-ray diffraction
Resolution: 2.42 Å
Organisms: Mus musculus, synthetic construct
Chains: 10
Atoms: 9,909
Mol. weight: 137.73 kDa
Released: 17 May 2005

Explore 1U3H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1U3H contains 30 α-helices and 113 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	3-4	2	1
β-strand	10-13	4	2
β-strand	18-24	7	1
β-strand	29-37	9	3
β-strand	44-50	7	3
β-strand	55-58	4	1
β-strand	62-67	6	1
α-helix	69-71	3
β-strand	72-77	6	1
β-strand	87-90	4	3
β-strand	93-98	2	3
α-helix	102-104	3
β-strand	110-111	2	3
β-strand	112-115	4	2

Chain B: 1 helix, 14 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	4
β-strand	10-12	3	5
β-strand	19-25	7	4
β-strand	31-34	4	6
β-strand	37-38	2	5
β-strand	42-43	2	5
β-strand	47-49	3	6
β-strand	56-57	2	6
β-strand	66-71	6	4
β-strand	74-79	6	4
α-helix	84-86	3
β-strand	89	1	5
β-strand	92-95	4	6
β-strand	106-108	3	6
β-strand	113-115	3	5

Chain C: 4 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	5-15	12	7
β-strand	19-26	8	7
β-strand	29-35	7	7
β-strand	40-43	4	7
α-helix	46-49	4
β-strand	53	1	8
α-helix	56-76	21
α-helix	80-85	6
β-strand	88-93	6	9
β-strand	103-112	10	9
β-strand	118-123	6	10
β-strand	126-128	3	10
β-strand	132-134	3	9
α-helix	137	1
β-strand	138-139	2	9
β-strand	145-153	9	9
β-strand	161-166	6	10
β-strand	174-178	5	10

Chain D: 8 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	7-18	12	7
β-strand	23-31	9	7
β-strand	36-41	6	7
β-strand	46-49	4	7
α-helix	52-54	3
α-helix	58-64	7
α-helix	68-74	7
α-helix	75-80	6
α-helix	81-82	2
α-helix	83-86	5
α-helix	90-92	3
β-strand	95	1	11
α-helix	96-97	2
β-strand	98-103	6	12
β-strand	113-122	10	12
β-strand	123	1	11
β-strand	128-133	6	13
β-strand	136-138	3	13
β-strand	142-144	3	12
β-strand	148-149	2	12
β-strand	155-163	9	12
β-strand	171-176	6	13
β-strand	184-188	5	13

Chain E: 2 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	14
β-strand	9-13	5	15
β-strand	18-24	7	14
β-strand	29-37	9	15
β-strand	44-50	7	15
β-strand	55-58	4	14
β-strand	62-67	6	14
α-helix	69-71	3
β-strand	72-77	6	14
β-strand	87-90	4	15
β-strand	91-92	2	16
β-strand	93-98	2	15
α-helix	102-104	3
β-strand	105-106	2	16
β-strand	110-115	6	15

Chain F: 1 helix, 14 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	17
β-strand	10-12	3	18
β-strand	19-21	3	17
β-strand	23-25	3	17
β-strand	31-37	7	19
β-strand	43-45	3	19
β-strand	47-48	2	20
β-strand	49	1	19
β-strand	56-57	2	20
β-strand	66-71	6	17
β-strand	74-79	6	17
α-helix	84-86	3
β-strand	90-95	6	19
β-strand	107-108	2	19
β-strand	113-115	3	18

Chain G: 3 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	5-15	12	21
β-strand	19-26	8	21
β-strand	29-35	7	21
β-strand	40-43	4	21
α-helix	46-49	4
β-strand	53	1	22
α-helix	56-76	21
α-helix	80-82	3
β-strand	88-93	6	23
β-strand	103-112	10	23
β-strand	118-123	6	24
β-strand	126-127	2	24
β-strand	132-134	3	23
β-strand	138-139	2	23
β-strand	145-153	9	23
β-strand	161-166	6	24
β-strand	174-178	5	24

Chain H: 8 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	7-18	12	21
β-strand	23-31	9	21
β-strand	36-41	6	21
β-strand	46-49	4	21
α-helix	52-54	3
α-helix	55-64	10
α-helix	68-74	7
α-helix	75-80	6
α-helix	81-82	2
α-helix	83-86	5
α-helix	90-92	3
β-strand	95	1	25
α-helix	96-97	2
β-strand	98-103	6	26
β-strand	113-122	10	26
β-strand	123	1	25
β-strand	128-133	6	27
β-strand	136-138	3	27
β-strand	142-144	3	26
β-strand	148-149	2	26
β-strand	155-163	9	26
β-strand	170-176	7	27
β-strand	184-189	6	27

2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
T-cell receptor alpha-chain	A, E	protein	110	Mus musculus	Q5R1B3 (AlphaFold model)
Mouse TCRVbeta 172.10, extracellular variable domain	B, F	protein	111	Mus musculus	P04213 (AlphaFold model)
H-2 class II histocompatibility antigen, A-U alpha chain	C, G	protein	182	Mus musculus	P14438 (AlphaFold model)
H-2 class II histocompatibility antigen, A-U beta chain	D, H	protein	189	Mus musculus	P06344 (AlphaFold model)
Myelin basic protein (MBP)-peptide	I, P	protein	12	synthetic construct	P04370

Sequence of entity 1 (A, E), FASTA

>1U3H_1 T-cell receptor alpha-chain (chains A, E)
QVRQSPQSLTVWEGETAILNCSYENSAFDYFPWYQQFPGEGPALLISILSVSDKKEDGRF
TIFFNKREKKLSLHIADSQPGDSATYFCAASANSGTYQRFGTGTKLQVVP

Sequence of entity 2 (B, F), FASTA

>1U3H_2 Mouse TCRVbeta 172.10, extracellular variable domain (chains B, F)
AVTQSPRNKVAVTGEKVTLSCNQTNNHNNMYWYRQDTGHGLRLIYYSYGAGSTEKGDIPD
GYKASRPSQENFSLTLESATPSQTSVYFCASGDAGGGYEQYFGPGTRLTVL

Sequence of entity 3 (C, G), FASTA

>1U3H_3 H-2 class II histocompatibility antigen, A-U alpha chain (chains C, G)
IEADHVGSYGIVVYQSPGDIGQYTFEFDGDELFYVDLDKKETIWMLPEFAQLRSFDPQGG
LQNIATGKHNLGVLTKRSNSTPATNEAPQATVFPKSPVLLGQPNTLICFVDNIFPPVINI
TWLRNSKSVADGVYETSFFVNRDYSFHKLSYLTFIPSDDDIYDCKVEHWGLEEPVLKHWE
PE

Sequence of entity 4 (D, H), FASTA

>1U3H_4 H-2 class II histocompatibility antigen, A-U beta chain (chains D, H)
GDSERHFVVQFQPFCYFTNGTQRIRYVTRYIYNREEYLRFDSDVGEYRAVTELGRPDAEY
YNKQYLERTRAELDTVCRYNYEETEVPTSLRRLEQPNVVISLSRTEALNHHNTLVCSVTD
FYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLK
SPITVEWRA

Sequence of entity 5 (I, P), FASTA

>1U3H_5 Myelin basic protein (MBP)-peptide (chains I, P)
SRGGASQYRPSQ

Primary citation

Structure of an autoimmune T cell receptor complexed with class II peptide-MHC: insights into MHC bias and antigen specificity. Maynard, J., Petersson, K., Wilson, D.H. et al. Immunity (2005) 22:81-92. DOI 10.1016/j.immuni.2004.11.015 · PubMed

Other PDB entries of the same protein (UniProt Q5R1B3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2P1Y 2.42 Å, 1.B2.D9, a bispecific alpha/beta TCR
1B88 2.5 Å, V-alpha 2.6 mouse T cell receptor (TCR) domain

Browse structure collections

About this viewer

MolViewer shows 1U3H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.