1U3O: Rat Kalirin N-terminal SH3 domain

Solution structure of rat Kalirin N-terminal SH3 domain. Determined by solution NMR. Released 26 Jul 2005.

Method: Solution NMR
Organism: Rattus norvegicus
Chains: 1
Atoms: 502
Mol. weight: 8.58 kDa
Released: 26 Jul 2005

Explore 1U3O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1U3O contains 2 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	18-21	4	1
β-strand	26	1	2
β-strand	36	1	2
β-strand	41-44	4	1
β-strand	54-59	6	1
α-helix	65	1
β-strand	66-71	6	1
α-helix	72-74	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Huntingtin-associated protein-interacting protein	A	protein	82	Rattus norvegicus	P97924 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1U3O_1 Huntingtin-associated protein-interacting protein (chains A)
GPLGSPGIPGSTLSGGCELTVVLQDFSAAHSSELSIQVGQTVELLERPSERPGWCLVRTT
ERSPPQEGLVPSSTLCISHSRS

Primary citation

Regulation of RhoGEF Activity by Intramolecular and Intermolecular SH3 Domain Interactions. Schiller, M.R., Chakrabarti, K., King, G.F. et al. J Biol Chem (2006) 281:18774-18786. DOI 10.1074/jbc.M512482200 · PubMed

Other PDB entries of the same protein (UniProt P97924 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9IFK 1.34 Å, Crystal structure of Kalirin/Rac1 in complex with DK-2
9HU8 1.48 Å, Crystal structure of Kalirin/Rac1 in complex with MC-278.
5O33 1.64 Å, A structure of the GEF Kalirin DH1 domain in complex with the small GTPase Rac1
9IG1 1.65 Å, Crystal structure of Kalirin/Rac1 in complex with DK-652
9I1L 1.68 Å, Crystal structure of Kalirin/Rac1 in complex with RS-009
2KR9 Kalirin DH1 NMR structure

Browse structure collections

About this viewer

MolViewer shows 1U3O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.