1U42: Nuclear factor NF-kappa-B p105 subunit

Name: PDB 1U42: Crystal structure of MLAM mutant of dimerisation domain of NF-kB p50 transcription factor
Published: 2004-08-17
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Crystal structure of MLAM mutant of dimerisation domain of NF-kB p50 transcription factor. Determined by X-ray diffraction at 2.7 Å resolution. Released 17 Aug 2004.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Mus musculus
Chains: 1
Atoms: 814
Mol. weight: 12.26 kDa
Released: 17 Aug 2004

Explore 1U42 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1U42 contains 1 α-helix and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	252-253	2	1
β-strand	268-269	2	1
β-strand	281-284	4	2
β-strand	292-295	4	2
α-helix	313-316	4
β-strand	325-329	5	3
β-strand	332	1	4
β-strand	339	1	4
β-strand	343-347	5	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear factor NF-kappa-B p105 subunit	A	protein	106	Mus musculus	P25799 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1U42_1 Nuclear factor NF-kappa-B p105 subunit (chains A)
ASNLKIVRMDRTAGCVTGGEEIMLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVH
RQFAIMFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPE

Primary citation

Snapshot of Protein Structure Evolution Reveals Conservation of Functional Dimerization through Intertwined Folding. Chirgadze, D.Y., Demydchuk, M., Becker, M. et al. Structure (2004) 12:1489-1494. DOI 10.1016/j.str.2004.06.011 · PubMed

Other PDB entries of the same protein (UniProt P25799 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1U36 1.89 Å, Crystal structure of WLAC mutant of dimerisation domain of NF-kB p50 transcription factor
1U3Z 1.9 Å, Crystal structure of MLAC mutant of dimerisation domain of NF-kB p50 transcription factor
1U3J 1.9 Å, Crystal structure of MLAV mutant of dimerisation domain of NF-kB p50 transcription factor
1U3Y 1.9 Å, Crystal structure of ILAC mutant of dimerisation domain of NF-kB p50 transcription factor
9BOR 2.0 Å, IkappaBzeta ankyrin repeat domain:NF-kappaB p50 homodimer complex at 2.0 Angstrom…
1BFS 2.2 Å, Structure of nf-kb P50 homodimer bound to a kb site
1U41 2.2 Å, Crystal structure of YLGV mutant of dimerisation domain of NF-kB p50 transcription factor
1IKN 2.3 Å, Ikappabalpha/nf-kappab complex
1NFK 2.3 Å, Structure of the nuclear factor kappa-B (nf-kb) P50 homodimer
1OOA 2.45 Å, Crystal structure of nf-kB(p50)2 complexed to a high-affinity RNA aptamer
1LEI 2.7 Å, The kB DNA sequence from the HLV-LTR functions as an allosteric regulator of HIV…
1LE5 2.75 Å, Crystal structure of a NF-kB heterodimer bound to an IFNb-kB

Browse structure collections

About this viewer

MolViewer shows 1U42 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.