1U5M: Alpha 1 type II collagen isoform 1

Structure of a Chordin-like Cysteine-rich Repeat (VWC module) from Collagen IIA. Determined by solution NMR. Released 5 Oct 2004.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 550
Mol. weight: 7.98 kDa
Released: 5 Oct 2004

Explore 1U5M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1U5M contains 0 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	10-11	2	1
β-strand	16-17	2	1
β-strand	22-23	2	2
β-strand	29-34	6	2
β-strand	37-42	6	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
alpha 1 type II collagen isoform 1	A	protein	73	Homo sapiens	P02458 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1U5M_1 alpha 1 type II collagen isoform 1 (chains A)
YVEFQEAGSCVQDGQRYNDKDVWKPEPCRICVCDTGTVLCDDIICEDVKDCLSPEIPFGE
CCPICPADLAAAA

Primary citation

Solution structure and dynamics of a prototypical chordin-like cysteine-rich repeat (von Willebrand Factor type C module) from collagen IIA. O'Leary, J.M., Hamilton, J.M., Deane, C.M. et al. J Biol Chem (2004) 279:53857-53866. DOI 10.1074/jbc.M409225200 · PubMed

Other PDB entries of the same protein (UniProt P02458 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6HG7 1.0 Å, Crystal structure of a collagen II fragment containing the binding site of PEDF and…
5NIR 1.74 Å, Crystal structure of collagen 2A vWC domain
5OCX 1.75 Å, Crystal structure of ACPA E4 in complex with CII-C-13-CIT
7NZE 2.05 Å, Crystal structure of HLA-DR4 in complex with a human collagen type II peptide
6NIX 2.1 Å, Crystal structure of Immune Receptor
2SEB 2.5 Å, X-ray crystal structure of HLA-DR4 complexed with a peptide from human collagen II
6BIN 2.5 Å, HLA-DRB1 in complex with Type II collagen peptide
5OCY 2.6 Å, Crystal structure of ACPA E4 in complex with CII-C-48-CIT
5MV4 2.9 Å, ACC1 Fab fragment in complex with citrullinated CII616-639 epitope of collagen type II…
2FSE 3.1 Å, Crystallographic structure of a rheumatoid arthritis MHC susceptibility allele, HLA-DR1…

Browse structure collections

About this viewer

MolViewer shows 1U5M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.