1U7L: Subunit C (vma5p) of the yeast V-ATPase

Crystal Structure of subunit C (vma5p) of the yeast V-ATPase. Determined by X-ray diffraction at 1.75 Å resolution. Released 23 Nov 2004.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 3,428
Mol. weight: 44.39 kDa
Ligands: TLA
Released: 23 Nov 2004

Explore 1U7L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1U7L contains 17 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	10-17	8	1
α-helix	30-36	7
α-helix	38-41	4
β-strand	44-47	4	1
β-strand	54	1	2
α-helix	58-60	3
α-helix	61-88	28
β-strand	102	1	3
β-strand	105	1	3
α-helix	107-112	6
β-strand	126	1	2
α-helix	127-165	39
α-helix	181-183	3
β-strand	191-199	9	4
α-helix	200-202	3
α-helix	203-209	7
α-helix	210-212	3
β-strand	217	1	4
α-helix	218	1
β-strand	223-227	5	4
β-strand	231-239	9	4
α-helix	240-242	3
α-helix	243-252	10
β-strand	256-258	3	4
α-helix	264-319	56
β-strand	325-332	8	1
α-helix	333	1
α-helix	337-348	12
α-helix	349-352	4
β-strand	386-391	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vacuolar ATP synthase subunit C	A	protein	392	Saccharomyces cerevisiae	P31412 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1U7L_1 Vacuolar ATP synthase subunit C (chains A)
MATALYTANDFILISLPQNAQPVTAPGSKTDSWFNETLIGGRAFVSDFKIPEFKIGSLDT
LIVESEELSKVDNQIGASIGKIIEILQGLNETSTNAYRTLPINNMPVPEYLENFQWQTRK
FKLDKSIKDLITLISNESSQLDADVRATYANYNSAKTNLAAAERKKTGDLSVRSLHDIVK
PEDFVLNSEHLTTVLVAVPKSLKSDFEKSYETLSKNVVPASASVIAEDAEYVLFNVHLFK
KNVQEFTTAAREKKFIPREFNYSEELIDQLKKEHDSAASLEQSLRVQLVRLAKTAYVDVF
INWFHIKALRVYVESVLRYGLPPHFNIKIIAVPPKNLSKCKSELIDAFGFLGGNAFMKDK
KGKINKQDTSLHQYASLVDTEYEPFVMYIINL

Ligands and cofactors

ID	Name	Formula	Copies
TLA	L(+)-tartaric acid	C4 H6 O6	1

Primary citation

Crystal structure of yeast V-ATPase subunit C reveals its stator function. Drory, O., Frolow, F., Nelson, N. EMBO Rep (2004) 5:1148-1152. DOI 10.1038/sj.embor.7400294 · PubMed

Other PDB entries of the same protein (UniProt P31412 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4EFA 2.82 Å, Crystal Structure of the Heterotrimeric EGChead Peripheral Stalk Complex of the Yeast…
4DL0 2.9 Å, Crystal Structure of the heterotrimeric EGChead Peripheral Stalk Complex of the Yeast…
7TMM 3.5 Å, Complete V1 Complex from Saccharomyces cerevisiae
7TMR 3.5 Å, V-ATPase from Saccharomyces cerevisiae, State 1
9MOY 3.6 Å, Reconstituted yeast V-ATPase bound to Rtc5p
7FDE 3.8 Å, CryoEM Structures of Reconstituted V-ATPase, Oxr1 bound V1
9ODU 3.9 Å, Yeast V-ATPase bound to Rtc5p, rotary state 2
7FDA 4.2 Å, CryoEM Structure of Reconstituted V-ATPase, state1
7FDB 4.8 Å, CryoEM Structures of Reconstituted V-ATPase,State2
6O7V 6.6 Å, Saccharomyces cerevisiae V-ATPase Stv1-V1VO State 1
7FDC 6.6 Å, CryoEM Structures of Reconstituted V-ATPase, state3
5VOX 6.8 Å, Yeast V-ATPase in complex with Legionella pneumophila effector SidK (rotational state 1)

Browse structure collections

About this viewer

MolViewer shows 1U7L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.