1U7R: Myoglobin

Crystal structure of Native Sperm Whale myoglobin from low ionic strength enviroment (Form2 ). Determined by X-ray diffraction at 1.15 Å resolution. Released 19 Jul 2005.

Method: X-ray diffraction
Resolution: 1.15 Å
Organism: Physeter catodon
Chains: 1
Atoms: 1,449
Mol. weight: 17.92 kDa
Ligands: HEM
Released: 19 Jul 2005

Explore 1U7R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1U7R contains 10 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	4-17	14
α-helix	18-20	3
α-helix	21-35	15
α-helix	37-42	6
α-helix	52-57	6
α-helix	59-76	18
α-helix	83-95	13
α-helix	101-118	18
α-helix	120-122	3
α-helix	125-148	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myoglobin	A	protein	153	Physeter catodon	P02185 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1U7R_1 Myoglobin (chains A)
VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASED
LKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHP
GDFGADAQGAMNKALELFRKDIAAKYKELGYQG

Ligands and cofactors

ID	Name	Formula	Copies
HEM	Protoporphyrin IX containing FE	C34 H32 Fe N4 O4	1

Water and common crystallization additives (IMD) are not listed.

Primary citation

Sampling of the native conformational ensemble of myoglobin via structures in different crystalline environments. Kondrashov, D.A., Zhang, W., Aranda, R. et al. Proteins (2008) 70:353-362. DOI 10.1002/prot.21499 · PubMed

Other PDB entries of the same protein (UniProt P02185 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5YCE 0.77 Å, Sperm whale myoglobin swMb
7VDN 0.93 Å, High resolution crystal structure of Sperm Whale Myoglobin in the carbonmonoxy form
1A6M 1.0 Å, Oxy-myoglobin, atomic resolution
1NAZ 1.04 Å, structure of microgravity-grown oxidized myoglobin mutant YQR (ISS8A)
8ESU 1.04 Å, Myoglobin variant Mb-imi complex
1A6K 1.1 Å, Aquomet-myoglobin, atomic resolution
2EKT 1.1 Å, Crystal structure of myoglobin reconstituted with 6-methyl-6-depropionatehemin
3O89 1.1 Å, Crystal Structure of Sperm Whale Myoglobin G65T
6M8F 1.1 Å, Engineered sperm whale myoglobin-based carbene transferase
9P1F 1.1 Å, Myoglobin variant RR22 in complex with imidazole
4H07 1.14 Å, Complex of G65T Myoglobin with Phenol in its Proximal Cavity
1A6G 1.15 Å, Carbonmonoxy-myoglobin, atomic resolution

Browse structure collections

About this viewer

MolViewer shows 1U7R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.