1UC6: Ciliary Neurotrophic Factor Receptor alpha

Solution Structure of the Carboxyl Terminal Domain of the Ciliary Neurotrophic Factor Receptor. Determined by solution NMR. Released 10 Aug 2004.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 876
Mol. weight: 12.33 kDa
Released: 10 Aug 2004

Explore 1UC6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1UC6 contains 2 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	8-11	4
β-strand	12-18	7	1
α-helix	19	1
β-strand	26-31	6	1
β-strand	44	1	2
β-strand	46-52	7	3
β-strand	61-63	3	3
β-strand	68-71	4	1
β-strand	80-85	6	3
β-strand	88	1	2
β-strand	99-103	5	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ciliary Neurotrophic Factor Receptor alpha	A	protein	109	Homo sapiens	P26992 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1UC6_1 Ciliary Neurotrophic Factor Receptor alpha (chains A)
GPLGSVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPLKFFLRYRPLILDQWQH
VELSNGTAHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHATPWTEE

Primary citation

Solution structure of the C-terminal domain of the ciliary neurotrophic factor (CNTF) receptor and ligand free associations among components of the CNTF receptor complex. Man, D., He, W., Sze, K.H. et al. J Biol Chem (2003) 278:23285-23294. DOI 10.1074/jbc.M301976200 · PubMed

Other PDB entries of the same protein (UniProt P26992 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8D7E 2.93 Å, Cryo-EM structure of human CNTFR alpha in complex with the Fab fragments of two antibodies
8D74 3.03 Å, Cryo-EM structure of human CNTF signaling complex: model containing the interaction core…
8D7H 3.4 Å, Cryo-EM structure of human CLCF1 in complex with CRLF1 and CNTFR alpha
8D7R 3.9 Å, Cryo-EM structure of human CLCF1 signaling complex: model containing the interaction…

Browse structure collections

About this viewer

MolViewer shows 1UC6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.