1UCH: Deubiquitinating enzyme uch-L3

Deubiquitinating enzyme uch-L3 (HUMAN) at 1.8 Å resolution. Determined by X-ray diffraction at 1.8 Å resolution. Released 28 Jan 1998.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,764
Mol. weight: 26.21 kDa
Released: 28 Jan 1998

Explore 1UCH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1UCH contains 10 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	6-8	3
α-helix	13-22	10
β-strand	25	1	1
β-strand	29-34	6	2
α-helix	39-42	4
β-strand	49-57	9	2
α-helix	60-76	17
α-helix	92-94	3
α-helix	95-105	11
α-helix	108-110	3
β-strand	113	1	1
α-helix	118-125	8
α-helix	131-140	10
β-strand	168-176	9	2
β-strand	179-183	5	2
β-strand	191-195	5	2
α-helix	201-215	15
β-strand	223-229	7	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin C-terminal hydrolase uch-L3	A	protein	230	Homo sapiens	P15374 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1UCH_1 UBIQUITIN C-TERMINAL HYDROLASE UCH-L3 (chains A)
MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITE
KYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLK
KFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHL
YELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA

Primary citation

Crystal structure of a deubiquitinating enzyme (human UCH-L3) at 1.8 A resolution. Johnston, S.C., Larsen, C.N., Cook, W.J. et al. EMBO J (1997) 16:3787-3796. DOI 10.1093/emboj/16.13.3787 · PubMed

Other PDB entries of the same protein (UniProt P15374 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1XD3 1.45 Å, Crystal structure of UCHL3-UbVME complex
7YV4 1.58 Å, Crystal structure of human UCHL3 in complex with Farrerol
13DF 1.84 Å, Crystal structure of covalent inhibitor 3-(2-chloroacetamido)-N-(3-methoxyphenyl)benzamid…
6ISU 1.87 Å, Crystal structure of Lys27-linked di-ubiquitin in complex with its selective interacting…
13CV 1.94 Å, Crystal structure of covalent inhibitor 3-(2-chloroacetamido)-N-(pyridin-2-yl)benzamide…
13CU 1.95 Å, Crystal structure of covalent inhibitor 2-chloro-N-(3-((pyridin-2-ylthio)methyl)phenyl)ac…
6QML 2.1 Å, UCHL3 in complex with synthetic, K27-linked diubiquitin
13CW 2.48 Å, Crystal structure of covalent inhibitor 3-(2-chloroacetamido)-N-(m-tolyl)benzamide bound…
35YH 2.6 Å, Crystal structure of covalent inhibitor 3-(2-chloroacetamido)-N-(3-hydroxyphenyl)benzamid…

Browse structure collections

About this viewer

MolViewer shows 1UCH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.