35YH: Ubiquitin carboxyl-terminal hydrolase isozyme L3

Crystal structure of covalent inhibitor 3-(2-chloroacetamido)-N-(3-hydroxyphenyl)benzamide bound to Ubiquitin C-terminal Hydrolase-L3. Determined by X-ray diffraction at 2.6 Å resolution. Released 26 Aug 2026.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,217
Mol. weight: 109.21 kDa
Ligands: A1DIP
Released: 26 Aug 2026

Explore 35YH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

35YH contains 35 α-helices and 32 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	9-11	3
α-helix	13-22	10
β-strand	25	1	3
β-strand	31-34	4	4
α-helix	39-42	4
β-strand	51-57	7	4
α-helix	60-76	17
α-helix	95-105	11
α-helix	108-110	3
β-strand	113	1	3
α-helix	119-126	8
α-helix	131-139	9
β-strand	168-176	9	4
β-strand	179-183	5	4
β-strand	191-195	5	4
α-helix	201-214	14
β-strand	223-227	5	4

Chain B: 9 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	9-11	3
α-helix	13-22	10
β-strand	25	1	1
β-strand	31-33	3	2
α-helix	42-44	3
β-strand	51-57	7	2
α-helix	60-76	17
α-helix	95-105	11
α-helix	108-110	3
β-strand	113	1	1
α-helix	118-126	9
α-helix	131-140	10
β-strand	168-176	9	2
β-strand	179-183	5	2
β-strand	191-195	5	2
α-helix	201-215	15
β-strand	223-227	5	2

Chain C: 9 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	9-11	3
α-helix	13-22	10
β-strand	25	1	5
β-strand	31-33	3	6
α-helix	39-42	4
β-strand	51-57	7	6
α-helix	60-72	13
α-helix	95-105	11
α-helix	108-110	3
β-strand	113	1	5
α-helix	118-126	9
α-helix	135-140	6
β-strand	168-176	9	6
β-strand	179-183	5	6
β-strand	191-195	5	6
α-helix	201-215	15
β-strand	223-227	5	6

Chain D: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	29-33	5	7
α-helix	39-42	4
β-strand	49-52	4	7
β-strand	56-57	2	8
α-helix	60-75	16
α-helix	96-105	10
α-helix	118-126	9
α-helix	131-135	5
β-strand	168-169	2	8
β-strand	172-173	2	7
β-strand	182-183	2	7
α-helix	190	1
β-strand	191	1	7
α-helix	192	1
α-helix	201-215	15
β-strand	225-229	5	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin carboxyl-terminal hydrolase isozyme L3	A, B, C, D	protein	238	Homo sapiens	P15374 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>35YH_1 Ubiquitin carboxyl-terminal hydrolase isozyme L3 (chains A, B, C, D)
GPLGSPEFMEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAV
LLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMH
FESGSTLKKFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIA
LVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA

Ligands and cofactors

ID	Name	Formula	Copies
A1DIP	3-(2-chloroacetamido)-N-(3-hydroxyphenyl)benzamide	C15 H13 Cl N2 O3	4

Primary citation

Identification, optimization, and structural elucidation of chloroacetamide scaffold as covalent inhibitors for Ubiquitin C-terminal Hydrolase L3. Beeralingappa, N.C., Lu, M., Patel, R. et al. bioRxiv (2026). DOI 10.64898/2026.05.26.727856

Other PDB entries of the same protein (UniProt P15374 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1XD3 1.45 Å, Crystal structure of UCHL3-UbVME complex
7YV4 1.58 Å, Crystal structure of human UCHL3 in complex with Farrerol
1UCH 1.8 Å, Deubiquitinating enzyme uch-L3 (HUMAN) at 1.8 Å resolution
13DF 1.84 Å, Crystal structure of covalent inhibitor 3-(2-chloroacetamido)-N-(3-methoxyphenyl)benzamid…
6ISU 1.87 Å, Crystal structure of Lys27-linked di-ubiquitin in complex with its selective interacting…
13CV 1.94 Å, Crystal structure of covalent inhibitor 3-(2-chloroacetamido)-N-(pyridin-2-yl)benzamide…
13CU 1.95 Å, Crystal structure of covalent inhibitor 2-chloro-N-(3-((pyridin-2-ylthio)methyl)phenyl)ac…
6QML 2.1 Å, UCHL3 in complex with synthetic, K27-linked diubiquitin
13CW 2.48 Å, Crystal structure of covalent inhibitor 3-(2-chloroacetamido)-N-(m-tolyl)benzamide bound…

Browse structure collections

About this viewer

MolViewer shows 35YH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.