1UCT: Extracellular fragment of Fc alpha Receptor I

Crystal structure of the extracellular fragment of Fc alpha Receptor I (CD89). Determined by X-ray diffraction at 2.1 Å resolution. Released 22 Jul 2003.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,590
Mol. weight: 25.01 kDa
Released: 22 Jul 2003

Explore 1UCT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1UCT contains 3 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	3-5	3
β-strand	11-13	3	1
β-strand	18-20	3	2
β-strand	25-29	5	1
β-strand	37-44	8	3
β-strand	47-50	4	3
β-strand	53-54	2	1
β-strand	64-67	4	1
α-helix	72-74	3
β-strand	76-84	9	3
β-strand	88-91	4	3
β-strand	95-97	3	3
β-strand	98-100	3	2
β-strand	107-110	4	4
β-strand	115-116	2	5
β-strand	123-127	5	4
β-strand	135-140	6	2
β-strand	149-151	3	2
β-strand	156-159	4	4
α-helix	165-167	3
β-strand	169-176	8	2
β-strand	183-184	2	2
β-strand	191-193	3	2
β-strand	194-195	2	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Immunoglobulin alpha Fc receptor	A	protein	218	Homo sapiens	P24071 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1UCT_1 Immunoglobulin alpha Fc receptor (chains A)
MAQEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYREIGRRLKFWN
ETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRGLVLMPG
ENISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHPANFSLGPVDLNVSGIYRCYGWYNR
SPYLWSFPSNALELVVTDSIHQDYTTQNLILEHHHHHH

Primary citation

Crystal Structure of the Ectodomain of Human Fc{alpha}RI. Ding, Y., Xu, G., Yang, M. et al. J Biol Chem (2003) 278:27966-27970. DOI 10.1074/jbc.C300223200 · PubMed

Other PDB entries of the same protein (UniProt P24071 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9OFS 1.95 Å, Crystal structure of the human IGA2m2 FC fragment-FC-alpha receptor (CD89) complex
9OV2 2.3 Å, Crystal structure of human IGA2M1 FC fragment-FC-alpha receptor (CD89) complex
9OFR 2.65 Å, Crystal structure of the human IGA1 fc fragment-fc-alpha receptor (CD89) complex
1OVZ 3.0 Å, Crystal structure of human FcaRI
1OW0 3.1 Å, Crystal structure of human FcaRI bound to IgA1-Fc
8SKU 3.2 Å, Structure of human SIgA1 in complex with human CD89 (FcaR1)

Browse structure collections

About this viewer

MolViewer shows 1UCT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.