1UEZ: First PDZ domain of human KIAA1526 protein

Solution structure of the first PDZ domain of human KIAA1526 protein. Determined by solution NMR. Released 22 Nov 2003.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 730
Mol. weight: 10.4 kDa
Released: 22 Nov 2003

Explore 1UEZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1UEZ contains 2 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	10-12	3	1
β-strand	25-29	5	2
β-strand	37-42	6	2
α-helix	47-51	5
β-strand	59-62	4	1
β-strand	65-66	2	1
α-helix	72-78	7
β-strand	87-89	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
KIAA1526 Protein	A	protein	101	Homo sapiens	Q9P202 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1UEZ_1 KIAA1526 Protein (chains A)
GSSGSSGEVRLVSLRRAKAHEGLGFSIRGGSEHGVGIYVSLVEPGSLAEKEGLRVGDQIL
RVNDKSLARVTHAEAVKALKGSKKLVLSVYSAGRISGPSSG

Primary citation

Solution structure of the first PDZ domain of human KIAA1526 protein. Li, H., Kigawa, T., Muto, Y. et al. To be published.

Other PDB entries of the same protein (UniProt Q9P202 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KZ1 1.69 Å, Complex structure of Whirlin and Myosin XVa
7EP7 2.6 Å, The complex structure of Gpsm2 and Whirlin
1UF1 Solution structure of the second PDZ domain of human KIAA1526 protein
1UFX Solution structure of the third PDZ domain of human KIAA1526 protein

Browse structure collections

About this viewer

MolViewer shows 1UEZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.