7EP7: The complex structure of Gpsm2 and Whirlin

The complex structure of Gpsm2 and Whirlin. Determined by X-ray diffraction at 2.6 Å resolution. Released 4 May 2022.

Method: X-ray diffraction
Resolution: 2.6 Å
Organisms: Mus musculus, Homo sapiens
Chains: 2
Atoms: 2,557
Mol. weight: 41.01 kDa
Released: 4 May 2022

Explore 7EP7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7EP7 contains 17 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 0 β-strands

Element	Residues	Length
α-helix	13-29	17
α-helix	33-46	14
α-helix	51-68	18
α-helix	71-88	18
α-helix	91-108	18
α-helix	111-127	17
α-helix	131-151	21
α-helix	165-188	24
α-helix	191-207	17
α-helix	211-228	18
α-helix	231-248	18
α-helix	251-267	17
α-helix	271-286	16
α-helix	291-307	17
α-helix	312-326	15
α-helix	331-342	12

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	740-742	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
G-protein-signaling modulator 2	A	protein	340	Mus musculus	Q8VDU0 (AlphaFold model)
Whirlin	B	protein	30	Homo sapiens	Q9P202 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7EP7_1 G-protein-signaling modulator 2 (chains A)
GPGSASCLELALEGERLCKSGDCRAGVSFFEAAVQVGTEDLKTLSAIYSQLGNAYFYLHD
YAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDEAIVCCQRHLDISRELND
KVGEARALYNLGNVYHAKGKSFGCPGPQDTGEFPEDVRNALQAAVDLYEENLSLVTALGD
RAAQGRAFGNLGNTHYLLGNFRDAVIAHEQRLLIAKEFGDKAAERRAYSNLGNAYIFLGE
FETASEYYKKTLLLARQLKDRAVEAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIAQELKD
RIGEGRACWSLGNAYTALGNHDQAMHFAEKHLEISREVGD

Sequence of entity 2 (B), FASTA

>7EP7_2 Whirlin (chains B)
TNQHFVMVEVHRPDSEPDVNEVRALPQTRT

Primary citation

Promotion of row 1-specific tip complex condensates by Gpsm2-G alpha i provides insights into row identity of the tallest stereocilia. Shi, Y., Lin, L., Wang, C. et al. Sci Adv (2022) 8:eabn4556-eabn4556. DOI 10.1126/sciadv.abn4556 · PubMed

Other PDB entries of the same protein (UniProt Q8VDU0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3RO3 1.1 Å, crystal structure of LGN/mInscuteable complex
3RO2 2.3 Å, Structures of the LGN/NuMA complex
4G2V 2.4 Å, Structure complex of LGN binding with FRMPD1
4JHR 2.8 Å, An auto-inhibited conformation of LGN reveals a distinct interaction mode between GoLoco…
4G5O 2.9 Å, Structure of LGN GL4/Galphai3(Q147L) complex
4G5Q 2.9 Å, Structure of LGN GL4/Galphai1 complex
4G5R 3.48 Å, Structure of LGN GL4/Galphai3 complex
4G5S 3.62 Å, Structure of LGN GL3/Galphai3 complex

Browse structure collections

About this viewer

MolViewer shows 7EP7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.