Solution structure of the second PDZ domain of human KIAA1526 protein. Determined by solution NMR. Released 22 Nov 2003.
Explore 1UF1 in 3D Show helices and sheets RCSB PDB PDBe
1UF1 contains 2 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 21-27 | 7 | 1 |
| β-strand | 36-39 | 4 | 1 |
| β-strand | 49-53 | 5 | 1 |
| α-helix | 58-62 | 5 | |
| β-strand | 69-73 | 5 | 1 |
| β-strand | 76-77 | 2 | 1 |
| α-helix | 83-90 | 8 | |
| β-strand | 95-101 | 7 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| KIAA1526 protein | A | protein | 128 | Homo sapiens | Q9P202 (AlphaFold model) |
>1UF1_1 KIAA1526 protein (chains A) GSSGSSGDRRSTLHLLQGGDEKKVNLVLGDGRSLGLTIRGGAEYGLGIYITGVDPGSEAE GSGLKVGDQILEVNGRSFLNILHDEAVRLLKSSRHLILTVKDVGRLPHARTTVDETKWIA SSSGPSSG
Solution structure of the second PDZ domain of human KIAA1526 protein. Saito, K., Kigawa, T., Koshiba, S. et al. To be published.
Other PDB entries of the same protein (UniProt Q9P202 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1UF1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.