1UFI: Dimerization domain of human CENP-B

Crystal structure of the dimerization domain of human CENP-B. Determined by X-ray diffraction at 1.65 Å resolution. Released 17 Feb 2004.

Method: X-ray diffraction
Resolution: 1.65 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,694
Mol. weight: 29 kDa
Released: 17 Feb 2004

Explore 1UFI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1UFI contains 11 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	9-23	15
α-helix	30-49	20

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	6-8	3
α-helix	9-24	16
α-helix	30-49	20

Chain C: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	4-8	5
α-helix	9-23	15
α-helix	30-48	19

Chain D: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	5-8	4
α-helix	9-24	16
α-helix	30-47	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Major centromere autoantigen B	A, B, C, D	protein	64	Homo sapiens	P07199 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>1UFI_1 Major centromere autoantigen B (chains A, B, C, D)
GSHMPVPSFGEAMAYFAMVKRYLTSFPIDDRVQSHILHLEHDLVHVTRKNHARQAGVRGL
GHQS

Primary citation

Crystal structure of the human centromere protein B (CENP-B) dimerization domain at 1.65-A resolution. Tawaramoto, M.S., Park, S.-Y., Tanaka, Y. et al. J Biol Chem (2003) 278:51454-51461. DOI 10.1074/jbc.M310388200 · PubMed

Other PDB entries of the same protein (UniProt P07199 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KDR 2.11 Å, Crystal structure of human NRMT2 in complex with human centromere protein B peptide
1HLV 2.5 Å, Crystal structure of cenp-B(1-129) complexed with the cenp-B box DNA
1BW6 Human centromere protein B (cenp-B) DNA bindign domain RP1

Browse structure collections

About this viewer

MolViewer shows 1UFI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.