1UFU: Immunoglobulin-like transcript 2

Crystal structure of ligand binding domain of immunoglobulin-like transcript 2 (ILT2; LIR-1). Determined by X-ray diffraction at 3.0 Å resolution. Released 10 Aug 2004.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,355
Mol. weight: 22 kDa
Released: 10 Aug 2004

Explore 1UFU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1UFU contains 5 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	5-6	2
β-strand	7-11	5	1
β-strand	15-17	3	2
β-strand	22-27	6	1
β-strand	35-39	5	3
α-helix	45-49	5
α-helix	52-55	4
β-strand	59-62	4	1
β-strand	71-77	7	3
β-strand	78-79	2	4
β-strand	83-84	2	4
α-helix	86-88	3
β-strand	91-93	3	3
β-strand	94-96	3	2
β-strand	103-107	5	5
β-strand	119-123	5	5
β-strand	131-134	4	6
β-strand	145-146	2	6
β-strand	156-160	5	5
β-strand	171-172	2	7
β-strand	173-176	4	6
β-strand	184-185	2	2
α-helix	187-191	5
β-strand	192-193	2	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Immunoglobulin-like transcript 2	A	protein	197	Homo sapiens	Q8NHL6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1UFU_1 Immunoglobulin-like transcript 2 (chains A)
HLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTAPWITRIPQELVKKGQFP
IPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVTLQ
CDSQVAFDGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNS
PYEWSLPSDLLELLVLG

Primary citation

Kinetic and thermodynamic properties of the interaction between Immunoglobulin like transcript (ILT) and MHC class I. Shiroishi, M., Amano, K., Rasubala, L. et al. To be published.

Other PDB entries of the same protein (UniProt Q8NHL6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1UGN 1.8 Å, Crystal structure of LIR1.02, one of the alleles of LIR1
1G0X 2.1 Å, Crystal structure of the ligand binding domain of lir-1 (ILT2)
3D2U 2.21 Å, Structure of UL18, a Peptide-Binding Viral MHC Mimic, Bound to a Host Inhibitory Receptor
6EWO 2.3 Å, Crystal structure of non-phosphorylated form of RTF PHOSPHOPEPTIDE BOUND TO HLA-A2 in…
6EWA 2.39 Å, Crystal structure of HLA-A2 in complex with LILRB1
7KFK 2.63 Å, Crystal structure of LILRB1 D3D4 domain in complex with Plasmodium RIFIN (PF3D7_1373400)…
4LL9 2.69 Å, Crystal structure of D3D4 domain of the LILRB1 molecule
4NO0 2.7 Å, Crystal structure of non-phosphorylated form of RQA_V phosphopeptide bound to HLA-A2 in…
1VDG 2.8 Å, Crystal structure of LIR1.01, one of the alleles of LIR1
6ZDX 3.0 Å, RIFIN variable region bound to LILRB1 ectodomain
6K60 3.15 Å, Structural and functional basis for HLA-G isoform recognition of immune checkpoint…
6EWC 3.2 Å, Crystal structure of non-phosphorylated form of RLS PHOSPHOPEPTIDE BOUND TO HLA-A2 in…

Browse structure collections

About this viewer

MolViewer shows 1UFU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.